6C8C: Chimeric Pol kappa RIR Rev1 C-terminal domain

Chimeric Pol kappa RIR Rev1 C-terminal domain in complex with JHRE06. Determined by X-ray diffraction at 1.5 Å resolution. Released 12 Jun 2019.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Mus musculus
Chains: 2
Atoms: 2,396
Mol. weight: 28 kDa
Ligands: EQ7
Released: 12 Jun 2019

Explore 6C8C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6C8C contains 11 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	6-13	8
α-helix	15-16	2
β-strand	27	1	1
β-strand	30	1	1
α-helix	33-46	14
α-helix	52-67	16
α-helix	71-86	16
α-helix	91-111	21
β-strand	116-118	3	2

Chain B: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	6-16	11
β-strand	27	1	3
β-strand	30	1	3
α-helix	33-46	14
α-helix	52-67	16
α-helix	71-86	16
α-helix	92-112	21
β-strand	114-116	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chimeric protein of the Pol Kappa RIR helix and the Rev1 C-terminal domain	A, B	protein	119	Mus musculus	Q920Q2 (AlphaFold model), Q9QUG2 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6C8C_1 Chimeric protein of the Pol Kappa RIR helix and the Rev1 C-terminal domain (chains A, B)
SHMKSFFDKKRSERISNGGFRPAAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVR
YCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT

Ligands and cofactors

ID	Name	Formula	Copies
EQ7	8-chloro-2-(2,4-dichloroanilino)-3-(3-methylbutanoyl)-5-nitroquinolin-4(1H)-one	C20 H16 Cl3 N3 O4	1

Primary citation

A Small Molecule Targeting Mutagenic Translesion Synthesis Improves Chemotherapy. Wojtaszek, J.L., Chatterjee, N., Najeeb, J. et al. Cell (2019) 178:152. DOI 10.1016/j.cell.2019.05.028 · PubMed

Other PDB entries of the same protein (UniProt Q920Q2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6C59 2.03 Å, Chimeric Pol kappa RIR Rev1 C-terminal domain
4FJO 2.72 Å, Structure of the Rev1 CTD-Rev3/7-Pol kappa RIR complex
2LSG Solution structure of the mouse Rev1 C-terminal domain
2LSJ Solution structure of the mouse Rev1 CTD in complex with the Rev1-interacting Region…

Browse structure collections

About this viewer

MolViewer shows 6C8C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.