2LW8: Eph receptor

NMR solution structure of Eph receptor. Determined by solution NMR. Released 24 Jul 2013.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,473
Mol. weight: 20.99 kDa
Released: 24 Jul 2013

Explore 2LW8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LW8 contains 2 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	8-9	2	1
α-helix	10-13	4
β-strand	29-33	5	1
β-strand	41-46	6	1
β-strand	56-60	5	2
β-strand	72-79	8	1
β-strand	97-100	4	2
α-helix	111-114	4
β-strand	117-118	2	2
β-strand	128-129	2	1
β-strand	140-145	6	1
β-strand	157-161	5	2
β-strand	166-174	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ephrin type-A receptor 4	A	protein	183	Homo sapiens	P54764 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LW8_1 Ephrin type-A receptor 4 (chains A)
GSNEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRT
DWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKID
TIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKAPL
TVR

Primary citation

NMR solution structure of Eph receptor. Qin, H., Fan, J., Song, J. To be published.

Other PDB entries of the same protein (UniProt P54764 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OFV 1.43 Å, NMR-guided design of potent and selective EphA4 agonistic ligands
5JR2 1.75 Å, Crystal structure of the EphA4 LBD in complex with APYd3 peptide inhibitor
2WO1 1.85 Å, Crystal Structure of the EphA4 Ligand Binding Domain
4M4P 2.08 Å, Crystal structure of EPHA4 ectodomain
2WO3 2.35 Å, Crystal Structure of the EphA4-ephrinA2 complex
4W4Z 2.41 Å, Structure of the EphA4 LBD in complex with peptide
4W50 2.42 Å, Structure of the EphA4 LBD in complex with peptide
2WO2 2.45 Å, Crystal Structure of the EphA4-ephrinB2 complex
3GXU 2.5 Å, Crystal structure of Eph receptor and ephrin complex
9CY8 2.5 Å, Constrained b-hairpins targeting the EphA4 ligand binding domain
3CKH 2.8 Å, Crystal structure of Eph A4 receptor
4M4R 3.13 Å, Epha4 ectodomain complex with ephrin a5

Browse structure collections

About this viewer

MolViewer shows 2LW8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.