2LXL: Lip5(mit)2

Lip5(mit)2. Determined by solution NMR. Released 28 Nov 2012.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,319
Mol. weight: 20.86 kDa
Released: 28 Nov 2012

Explore 2LXL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LXL contains 9 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	5-9	5
α-helix	12-14	3
α-helix	18-30	13
α-helix	32-49	18
α-helix	56-74	19
α-helix	78-81	4
α-helix	83-106	24
α-helix	112-129	18
α-helix	136-157	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vacuolar protein sorting-associated protein VTA1 homolog	A	protein	183	Homo sapiens	Q9NP79 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LXL_1 Vacuolar protein sorting-associated protein VTA1 homolog (chains A)
MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFL
SKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT
ASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENED
AGA

Primary citation

Interactions of the Human LIP5 Regulatory Protein with Endosomal Sorting Complexes Required for Transport. Skalicky, J.J., Arii, J., Wenzel, D.M. et al. J Biol Chem (2012) 287:43910-43926. DOI 10.1074/jbc.M112.417899 · PubMed

Other PDB entries of the same protein (UniProt Q9NP79 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4TXR 1.0 Å, Crystal structure of LIP5 N-terminal domain complexed with CHMP1B MIM and CHMP5 MIM
4U7E 1.6 Å, The crystal structure of the complex of LIP5 NTD and IST1 MIM
4TXQ 2.21 Å, Crystal structure of LIP5 N-terminal domain complexed with CHMP1B MIM
4TXP 3.01 Å, Crystal structure of LIP5 N-terminal domain
2LXM Lip5-chmp5

Browse structure collections

About this viewer

MolViewer shows 2LXL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.