4U7E: Complex of LIP5 NTD and IST1 MIM

The crystal structure of the complex of LIP5 NTD and IST1 MIM. Determined by X-ray diffraction at 1.6 Å resolution. Released 11 Feb 2015.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,607
Mol. weight: 21.8 kDa
Released: 11 Feb 2015

Explore 4U7E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4U7E contains 13 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	323-331	9

Chain B: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	2-4	3
α-helix	6-11	6
α-helix	12-17	6
α-helix	18-26	9
α-helix	32-49	18
α-helix	54-74	21
α-helix	78-81	4
α-helix	83-106	24
α-helix	112-127	16
α-helix	128-131	4
α-helix	134-135	2
α-helix	136-157	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vacuolar protein sorting-associated protein VTA1 homolog	B	protein	163	Homo sapiens	Q9NP79 (AlphaFold model)
IST1 homolog	A	protein	25	Homo sapiens	P53990 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>4U7E_1 Vacuolar protein sorting-associated protein VTA1 homolog (chains B)
SMAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKF
LSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFY
TASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETP

Sequence of entity 2 (A), FASTA

>4U7E_2 IST1 homolog (chains A)
STSASEDIDFDDLSRRFEELKKKTW

Primary citation

Distinct Mechanisms of Recognizing Endosomal Sorting Complex Required for Transport III (ESCRT-III) Protein IST1 by Different Microtubule Interacting and Trafficking (MIT) Domains. Guo, E.Z., Xu, Z. J Biol Chem (2015) 290:8396-8408. DOI 10.1074/jbc.M114.607903 · PubMed

Other PDB entries of the same protein (UniProt Q9NP79 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4TXR 1.0 Å, Crystal structure of LIP5 N-terminal domain complexed with CHMP1B MIM and CHMP5 MIM
4TXQ 2.21 Å, Crystal structure of LIP5 N-terminal domain complexed with CHMP1B MIM
4TXP 3.01 Å, Crystal structure of LIP5 N-terminal domain
2LXL Lip5(mit)2
2LXM Lip5-chmp5

Browse structure collections

About this viewer

MolViewer shows 4U7E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.