4TXP: LIP5 N-terminal domain

Crystal structure of LIP5 N-terminal domain. Determined by X-ray diffraction at 3.01 Å resolution. Released 11 Feb 2015.

Method: X-ray diffraction
Resolution: 3.01 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,368
Mol. weight: 56.38 kDa
Released: 11 Feb 2015

Explore 4TXP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4TXP contains 32 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	8-11	4
α-helix	12-17	6
α-helix	18-26	9
α-helix	32-49	18
α-helix	54-73	20
α-helix	78-81	4
α-helix	83-106	24
α-helix	112-128	17
α-helix	129-131	3
α-helix	133-135	3
α-helix	136-157	22

Chain B: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	9-11	3
α-helix	12-17	6
α-helix	18-26	9
α-helix	32-49	18
α-helix	54-73	20
α-helix	78-81	4
α-helix	83-106	24
α-helix	112-128	17
α-helix	129-131	3
α-helix	133-135	3
α-helix	136-157	22

Chain C: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	9-11	3
α-helix	12-17	6
α-helix	18-26	9
α-helix	33-49	17
α-helix	56-72	17
α-helix	83-106	24
α-helix	112-128	17
α-helix	129-131	3
α-helix	133-135	3
α-helix	136-157	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vacuolar protein sorting-associated protein VTA1 homolog	A, B, C	protein	163	Homo sapiens	Q9NP79 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>4TXP_1 Vacuolar protein sorting-associated protein VTA1 homolog (chains A, B, C)
SMAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKF
LSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFY
TASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETP

Primary citation

A Novel Mechanism of Regulating the ATPase VPS4 by Its Cofactor LIP5 and the Endosomal Sorting Complex Required for Transport (ESCRT)-III Protein CHMP5. Vild, C.J., Li, Y., Guo, E.Z. et al. J Biol Chem (2015) 290:7291-7303. DOI 10.1074/jbc.M114.616730 · PubMed

Other PDB entries of the same protein (UniProt Q9NP79 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4TXR 1.0 Å, Crystal structure of LIP5 N-terminal domain complexed with CHMP1B MIM and CHMP5 MIM
4U7E 1.6 Å, The crystal structure of the complex of LIP5 NTD and IST1 MIM
4TXQ 2.21 Å, Crystal structure of LIP5 N-terminal domain complexed with CHMP1B MIM
2LXL Lip5(mit)2
2LXM Lip5-chmp5

Browse structure collections

About this viewer

MolViewer shows 4TXP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.