2LY8: Budding yeast chaperone Scm3

Name: PDB 2LY8: The budding yeast chaperone Scm3 recognizes the partially unfolded dimer of the centromere-specific Cse4/H4 histone variant
Published: 2012-12-12
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

The budding yeast chaperone Scm3 recognizes the partially unfolded dimer of the centromere-specific Cse4/H4 histone variant. Determined by solution NMR. Released 12 Dec 2012.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 966
Mol. weight: 13.72 kDa
Released: 12 Dec 2012

Explore 2LY8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LY8 contains 5 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	6-18	13
β-strand	27	1	1
α-helix	29-53	25
α-helix	69-94	26
β-strand	100	1	1
α-helix	102-111	10
α-helix	115-118	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Budding yeast chaperone Scm3	A	protein	121	Saccharomyces cerevisiae	P36012 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LY8_1 Budding yeast chaperone Scm3 (chains A)
LISKIPFARLVKEVTDEFTTKDQDLRWQSMAIMALQEASEAYLVGLLEHTNLLALHLVPR
GSKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
G

Primary citation

Identification of Functionally Conserved Regions in the Structure of the Chaperone/CenH3/H4 Complex. Hong, J., Feng, H., Zhou, Z. et al. J Mol Biol (2013) 425:536-545. DOI 10.1016/j.jmb.2012.11.021 · PubMed

Other PDB entries of the same protein (UniProt P36012 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8T0P 1.73 Å, Structure of Cse4 bound to Ame1 and Okp1
6UPH 2.7 Å, Structure of a Yeast Centromeric Nucleosome at 2.7 Angstrom resolution
7ON1 3.35 Å, Cenp-A nucleosome in complex with Cenp-C
8OW0 3.4 Å, Cryo-EM structure of CBF1-CCAN bound topologically to a centromeric CENP-A nucleosome
8OW1 3.7 Å, Cryo-EM structure of the yeast Inner kinetochore bound to a CENP-A nucleosome.
6QLD 4.15 Å, Structure of inner kinetochore CCAN-Cenp-A complex
2L5A Structural basis for recognition of centromere specific histone H3 variant by nonhistone…

Browse structure collections

About this viewer

MolViewer shows 2LY8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.