2L5A: PDB entry 2L5A

Structural basis for recognition of centromere specific histone H3 variant by nonhistone Scm3. Determined by solution NMR. Released 16 Mar 2011.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 1,803
Mol. weight: 27.03 kDa
Released: 16 Mar 2011

Explore 2L5A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L5A contains 12 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	6-16	11
α-helix	20-22	3
α-helix	29-55	27
α-helix	61-63	3
α-helix	66-71	6
α-helix	85-105	21
α-helix	137-139	3
α-helix	145-155	11
α-helix	172-191	20
α-helix	192-196	5
α-helix	197-198	2
α-helix	206-220	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone H3-like centromeric protein CSE4, Protein SCM3, Histone H4	A	protein	235	Saccharomyces cerevisiae	P02309 (AlphaFold model), P36012 (AlphaFold model), Q12334 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2L5A_1 Histone H3-like centromeric protein CSE4, Protein SCM3, Histone H4 (chains A)
MHHHHHHKKLLISKIPFARLVKEVTDEFTTKDQDLRWQSMAIMALQEASEAYLVGLLEHT
NLLALHAKRITIMKKDMQLARRIRGQFLVPRGSMERHKLADENMRKVWSNIISKYESIEE
QGDLVDLKTGEIVEDNGHIKTLTANNSTKDKRTKYTSVLRDIIDISDEEDGDKGGVKRIS
GLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG

Primary citation

Structural basis for recognition of centromere histone variant CenH3 by the chaperone Scm3. Zhou, Z., Feng, H., Zhou, B.R. et al. Nature (2011) 472:234-237. DOI 10.1038/nature09854 · PubMed

Other PDB entries of the same protein (UniProt P02309 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6RXK 1.35 Å, Crystal structure of CobB wt in complex with H4K16-Butyryl peptide
1Q1A 1.5 Å, Structure of the yeast Hst2 protein deacetylase in ternary complex with 2'-O-acetyl ADP…
1SZD 1.5 Å, Structural basis for nicotinamide cleavage and ADP-ribose transfer by NAD+-dependent…
6RXJ 1.6 Å, Crystal structure of CobB wt in complex with H4K16-Acetyl peptide
4TWJ 1.65 Å, The structure of Sir2Af2 bound to a myristoylated histone peptide
6RXQ 1.7 Å, Crystal structure of CobB Ac2 (A76G,I131C,V162A) in complex with H4K16Cr-2'OH-ADPr…
6RXR 1.7 Å, Crystal structure of CobB Ac2 (A76G, I131C, V162G) in complex with H4K16Cr-2'OH-ADPr…
1SZC 1.75 Å, Structural basis for nicotinamide cleavage and ADP-ribose transfer by NAD+-dependent…
4TWI 1.79 Å, The structure of Sir2Af1 bound to a succinylated histone peptide
6RXP 1.8 Å, Crystal structure of CobB Ac2 (A76G,I131C,V162A) in complex with H4K16-Crotonyl peptide
1E6I 1.87 Å, Bromodomain from GCN5 complexed with acetylated H4 peptide
6RXM 1.92 Å, Crystal structure of CobB Ac2 (A76G, I131C, V162G) in complex with H4K16-Acetyl peptide

Browse structure collections

About this viewer

MolViewer shows 2L5A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.