2M04: BCL-xL

Solution structure of BCL-xL in complex with PUMA BH3 peptide. Determined by solution NMR. Released 30 Jan 2013.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,612
Mol. weight: 23.73 kDa
Released: 30 Jan 2013

Explore 2M04 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2M04 contains 9 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	3-18	16
α-helix	43-94	12
α-helix	119-130	12
α-helix	137-177	41
α-helix	179-185	7
α-helix	188-196	9
α-helix	199-203	5

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	72-83	12
α-helix	84-88	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bcl-2-like protein 1	A	protein	180	Homo sapiens	Q07817 (AlphaFold model)
Bcl-2-binding component 3	B	protein	25	Homo sapiens	Q9BXH1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2M04_1 Bcl-2-like protein 1 (chains A)
MSAMSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQALREAGDEF
ELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDK
EMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERLEHHHHHH

Sequence of entity 2 (B), FASTA

>2M04_2 Bcl-2-binding component 3 (chains B)
EEQWAREIGAQLRRMADDLNAQYER

Primary citation

PUMA binding induces partial unfolding within BCL-xL to disrupt p53 binding and promote apoptosis. Follis, A.V., Chipuk, J.E., Fisher, J.C. et al. Nat Chem Biol (2013) 9:163-168. DOI 10.1038/nchembio.1166 · PubMed

Other PDB entries of the same protein (UniProt Q07817 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7JGW 1.3 Å, Crystal structure of BCL-XL in complex with COMPOUND 1620116, CRYSTAL FORM 1
3SP7 1.4 Å, Crystal Structure of Bcl-xL bound to BM903
7YAA 1.4 Å, Crystal structure analysis of cp3 bound BCLxl
7LH7 1.41 Å, Crystal structure of BCL-XL in complex with a benzothiazole-based inhibitor
9IGG 1.5 Å, Structure of human Bcl-xL in complex with small molecule inhibitor
4QVF 1.53 Å, Crystal structure of Bcl-xL in complex with BIM BH3 domain
4A1U 1.54 Å, Crystal structure of alpha-beta-foldamer 2c in complex with Bcl-xL
6VWC 1.6 Å, Crystal structure of Bcl-xL in complex with tetrahydroisoquinoline-pyridine based…
6O0K 1.62 Å, crystal structure of BCL-2 with venetoclax
3SPF 1.7 Å, Crystal Structure of Bcl-xL bound to BM501
9I9E 1.7 Å, Structure of human Bcl-xL in complex with small molecule inhibitor
9O14 1.73 Å, Crystal Structure of BCL-2 in complex with a stapled BAD BH3 peptide BAD SAHB 4.2

Browse structure collections

About this viewer

MolViewer shows 2M04 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.