2M0O: Human PHF1

The solution structure of human PHF1 in complex with H3K36me3. Determined by solution NMR. Released 16 Jan 2013.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 702
Mol. weight: 10 kDa
Released: 16 Jan 2013

Explore 2M0O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2M0O contains 0 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	36-38	3	1
β-strand	39	1	2
β-strand	48-55	8	1
β-strand	60-65	6	1
β-strand	70-74	5	1
β-strand	78	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PHD finger protein 1	A	protein	79	Homo sapiens	O43189 (AlphaFold model)
H3K36me3 peptide	B	protein	11		P68431 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2M0O_1 PHD finger protein 1 (chains A)
SRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQ
FEDDSQFLVLWKDISPAAL

Sequence of entity 2 (B), FASTA

>2M0O_2 H3K36me3 peptide (chains B)
ATGGVKKPHRY

Primary citation

An H3K36 Methylation-Engaging Tudor Motif of Polycomb-like Proteins Mediates PRC2 Complex Targeting. Cai, L., Rothbart, S.B., Lu, R. et al. Mol Cell (2013) 49:571-582. DOI 10.1016/j.molcel.2012.11.026 · PubMed

Other PDB entries of the same protein (UniProt O43189 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6WAV 1.7 Å, Crystal structure of PHF1 in complex with H3K36me3 substitution
6WAT 1.8 Å, complex structure of PHF1
4HCZ 1.85 Å, PHF1 Tudor in complex with H3K36me3
7LKY 1.85 Å, Crystal Structure of PHF1 Tudor domain in complex with a peptidomimetic ligand UNC6641
5XFN 1.9 Å, Structure of the N-terminal domains of PHF1
5XFO 1.9 Å, Structure of the N-terminal domains of PHF1
5XFP 2.3 Å, Binary complex of PHF1 and a double stranded DNA
8H43 2.3 Å, Crystal structure of PHF1 Tudor domain in complex with hit 1
2E5P Solution structure of the TUDOR domain of PHD finger protein 1 (PHF1 protein)

Browse structure collections

About this viewer

MolViewer shows 2M0O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.