TICAM-1 TIR domain structure. Determined by solution NMR. Released 15 Jan 2014.
Explore 2M1X in 3D Show helices and sheets RCSB PDB PDBe
2M1X contains 7 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 399-400 | 2 | 1 |
| α-helix | 406-417 | 12 | |
| α-helix | 444-447 | 4 | |
| β-strand | 452-455 | 4 | 1 |
| α-helix | 462-475 | 14 | |
| β-strand | 486-490 | 5 | 1 |
| α-helix | 503-506 | 4 | |
| β-strand | 513-514 | 2 | 1 |
| α-helix | 520-527 | 8 | |
| α-helix | 530-535 | 6 | |
| α-helix | 541-543 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| TIR domain-containing adapter molecule 1 | A | protein | 168 | Homo sapiens | Q8IUC6 (AlphaFold model) |
>2M1X_1 TIR domain-containing adapter molecule 1 (chains A) MESSSEQKFYNFVILHARADEHIALRVREKLEALGVPDGATFCEDFQVHGRGELSCLQDA IDHSAFIILLLTSNFDCRLSLHQVNQAMMSNLTRQGSPDCVIPFLPLESSPAQLSSDTAS LLSGLVRLDEHSQIFARKVANTFKPHRLQARKAMWRKEQDLEHHHHHH
Structures and interface mapping of the TIR domain-containing adaptor molecules involved in interferon signaling. Enokizono, Y., Kumeta, H., Funami, K. et al. Proc Natl Acad Sci U S A (2013) 110:19908-19913. DOI 10.1073/pnas.1222811110 · PubMed
Other PDB entries of the same protein (UniProt Q8IUC6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2M1X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.