2M3S: Calmodulin

Calmodulin, i85l, f92e, h107i, l112r, a128t, m144r mutant. Determined by solution NMR. Released 24 Jul 2013.

Method: Solution NMR
Organism: Gallus gallus
Chains: 1
Atoms: 1,195
Mol. weight: 17.27 kDa
Ligands: CA
Released: 24 Jul 2013

Explore 2M3S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2M3S contains 8 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	9-20	12
β-strand	30	1	1
α-helix	32-40	9
α-helix	48-58	11
β-strand	66	1	1
α-helix	68-78	11
α-helix	84-95	12
β-strand	103	1	2
α-helix	105-115	11
α-helix	121-131	11
β-strand	139	1	2
α-helix	141-150	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin	A	protein	151	Gallus gallus	P62149 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2M3S_1 Calmodulin (chains A)
SLMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA
DGNGTIDFPEFLTMMARKMKDTDSEEELREAFRVEDKDGNGYISAAELRIVMTNRGEKLT
DEEVDEMIRETDIDGDGQVNYEEFVQRMTAK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Primary citation

A single mutation in a regulatory protein produces evolvable allosterically regulated catalyst of nonnatural reaction. Moroz, O.V., Moroz, Y.S., Wu, Y. et al. Angew Chem Int Ed Engl (2013) 52:6246-6249. DOI 10.1002/anie.201302339 · PubMed

Other PDB entries of the same protein (UniProt P62149 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2O5G 1.08 Å, Calmodulin-smooth muscle light chain kinase peptide complex
3GOF 1.45 Å, Calmodulin bound to peptide from macrophage nitric oxide synthase
3GP2 1.46 Å, Calmodulin bound to peptide from calmodulin kinase II (CaMKII)
2O60 1.55 Å, Calmodulin bound to peptide from neuronal nitric oxide synthase
1AHR 1.8 Å, Calmodulin mutant with a two residue deletion in the central helix
1UP5 1.9 Å, Chicken Calmodulin
2BCX 2.0 Å, Crystal structure of calmodulin in complex with a ryanodine receptor peptide
2VB6 2.3 Å, Myosin VI (MD-insert2-CaM, Delta Insert1) Post-rigor state (crystal form 2)
5HIT 2.85 Å, Crystal Structure Analysis of Ca2+-calmodulin and a C-terminal EAG1 channel fragment
2BKI 2.9 Å, Myosin VI nucleotide-free (MDinsert2-IQ) crystal structure
6BNV 4.6 Å, CryoEM structure of MyosinVI-actin complex in the rigor (nucleotide-free) state,…
2KZ2 Calmodulin, C-terminal domain, F92E mutant

Browse structure collections

About this viewer

MolViewer shows 2M3S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.