2M5B: BID-BAK complex

Name: PDB 2M5B: The NMR structure of the BID-BAK complex
Published: 2013-04-17
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: apoptosis

The NMR structure of the BID-BAK complex. Determined by solution NMR. Released 17 Apr 2013.

Method: Solution NMR
Organisms: Homo sapiens, Synthetic construct
Chains: 2
Atoms: 1,515
Mol. weight: 21.48 kDa
Released: 17 Apr 2013

Explore 2M5B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2M5B contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	24-49	26
α-helix	70-81	12
α-helix	83-97	15
α-helix	107-118	12
α-helix	125-145	21
α-helix	151-162	12
α-helix	167-173	7
α-helix	177-182	6

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	81-88	8
α-helix	95-99	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bcl-2 homologous antagonist/killer	A	protein	169	Homo sapiens	Q16611 (AlphaFold model)
human_BID_BH3_SAHB	B	protein	23	Synthetic construct	P55957 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2M5B_1 Bcl-2 homologous antagonist/killer (chains A)
ALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQ
LAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYR
LALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNG

Sequence of entity 2 (B), FASTA

>2M5B_2 human_BID_BH3_SAHB (chains B)
EDIIRNIARHLALVGDLLDRSIX

Primary citation

BID-induced structural changes in BAK promote apoptosis. Moldoveanu, T., Grace, C.R., Llambi, F. et al. Nat Struct Mol Biol (2013) 20:589-597. DOI 10.1038/nsmb.2563 · PubMed

Other PDB entries of the same protein (UniProt Q16611 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5VX1 1.22 Å, Bak L100A
8CZF 1.3 Å, Human BAK in complex with the dF2 peptide
8CZH 1.3 Å, Human BAK in complex with the dM2 peptide
2IMS 1.48 Å, The X-ray Structure of a Bak Homodimer Reveals an Inhibitory Zinc Binding Site
2IMT 1.49 Å, The X-ray Structure of a Bak Homodimer Reveals an Inhibitory Zinc Binding Site
9CPE 1.49 Å, Structural basis of BAK sequestration by MCL-1 and consequences for apoptosis initiation
5FMI 1.49 Å, Human Bak Q77L
7M5A 1.5 Å, Crystal Structure of human BAK in complex with W3W5_BID
5VWY 1.55 Å, Bak core latch dimer in complex with Bim-h3Pc-RT
5VX0 1.6 Å, Bak in complex with Bim-h3Glg
5VWZ 1.62 Å, Bak in complex with Bim-h3Pc
6UXQ 1.7 Å, Crystal structure of BAK core domain BH3-groove-dimer in complex with POPC and C8E4

Browse structure collections

About this viewer

MolViewer shows 2M5B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.