2M75: Zinc metalloproteinase/disintegrin

The C-terminal Region of Disintegrin Modulate its 3D Conformation and Cooperate with RGD Loop in Regulating Recognitions of Integrins. Determined by solution NMR. Released 22 May 2013.

Method: Solution NMR
Organism: Calloselasma rhodostoma
Chains: 1
Atoms: 505
Mol. weight: 8.49 kDa
Released: 22 May 2013

Explore 2M75 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2M75 contains 1 α-helix and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 6 β-strands

Element	Residues	Length	Sheet
β-strand	14-15	2	1
β-strand	20-21	2	1
β-strand	33-34	2	2
β-strand	37-38	2	2
β-strand	41-46	6	3
α-helix	53-54	2
β-strand	55-58	4	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Zinc metalloproteinase/disintegrin	A	protein	76	Calloselasma rhodostoma	P30403 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2M75_1 Zinc metalloproteinase/disintegrin (chains A)
EFHHHHHHGKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIARGDW
NDDRCTGQSADCPRYH

Primary citation

The C-terminal Region of Disintegrin Modulate its 3D Conformation and Cooperate with RGD Loop in Regulating Recognitions of Integrins. Chuang, W., Chang, Y., Shiu, J. et al. To be published.

Other PDB entries of the same protein (UniProt P30403 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4R5R 0.96 Å, Crystal structure of Rhodostomin KKKRT mutant
3UCI 1.35 Å, Crystal structure of Rhodostomin ARLDDL mutant
7X4V 1.38 Å, Crystal structure of Rhodostomin ARGDDP mutant
7X4Z 1.48 Å, Crystal structure of Rhodostomin ARGDWP mutant
4RQG 1.66 Å, Crystal structure of Rhodostomin
7X4S 1.8 Å, Crystal structure of Rhodostomin ARGDMP mutant
26QZ 1.8 Å, Crystal structure of Rhodostomin ARGDP mutant
4R5U 1.81 Å, Crystal structure of Rhodostomin R46E mutant
9IUJ 2.78 Å, Integrin alpha-v beta-3 in complex with rhodostomin
1N4Y Refined structure of kistrin
1Q7I Structural Analysis of Integrin alpha IIb beta 3- Disintegrin with the AKGDWN Motif
1Q7J Structural Analysis of Integrin alpha IIb beta 3- Disintegrin with the AKGDWN Motif

Browse structure collections

About this viewer

MolViewer shows 2M75 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.