2M7Q: TAX1BP1 UBZ1+2

Solution structure of TAX1BP1 UBZ1+2. Determined by solution NMR. Released 4 Dec 2013.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 586
Mol. weight: 8.46 kDa
Ligands: ZN
Released: 4 Dec 2013

Explore 2M7Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2M7Q contains 3 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	9	1	1
β-strand	16	1	1
α-helix	23-33	11
β-strand	35-37	3	2
β-strand	42-44	3	2
α-helix	45	1
α-helix	50-62	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tax1-binding protein 1	A	protein	69	Homo sapiens	Q86VP1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2M7Q_1 Tax1-binding protein 1 (chains A)
GPHMDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTH
FDQNVLNFD

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

The structure of TAX1BP1 UBZ1+2 provides insight into target specificity and adaptability. Ceregido, M.A., Spinola Amilibia, M., Buts, L. et al. J Mol Biol (2014) 426:674-690. DOI 10.1016/j.jmb.2013.11.006 · PubMed

Other PDB entries of the same protein (UniProt Q86VP1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YT6 1.5 Å, Crystal structure of TAX1BP1 UBZ2 in complex with mono-ubiquitin
8W6A 1.53 Å, Crystal structure of TAX1BP1 LIR region in complex with GABARAP
4NLH 1.9 Å, SKICH domain of human TAX1BP1
4Z4M 2.15 Å, Crystal structure of GFP-TAX1BP1 UBZ2 domain fusion protein
5Z7G 2.3 Å, Crystal structure of TAX1BP1 SKICH region in complex with NAP1
8W6B 2.39 Å, crystal structure of TAX1BP1 SKICH domain in complex with RB1CC1 coiled-coil domain
4BMJ 2.75 Å, Structure of the UBZ1and2 tandem of the ubiquitin-binding adaptor protein TAX1BP1
4Z4K 2.8 Å, Crystal structure of GFP-TAX1BP1 UBZ1+2 domain fusion protein
5AAS The selective autophagy receptor TAX1BP1 is required for autophagy- dependent capture of…

Browse structure collections

About this viewer

MolViewer shows 2M7Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.