5AAS: TAX1-binding protein 1

The selective autophagy receptor TAX1BP1 is required for autophagy- dependent capture of cytosolic Salmonella typhimurium. Determined by solution NMR. Released 23 Sept 2015.

Method: Solution NMR
Organism: HOMO SAPIENS
Chains: 1
Atoms: 538
Mol. weight: 7.83 kDa
Ligands: ZN
Released: 23 Sept 2015

Explore 5AAS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5AAS contains 2 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	728-729	2	1
β-strand	736-737	2	1
α-helix	743-753	11
β-strand	755-756	2	2
β-strand	763-764	2	2
α-helix	770-779	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TAX1-binding protein 1	A	protein	64	HOMO SAPIENS	Q86VP1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5AAS_1 TAX1-BINDING PROTEIN 1 (chains A)
GSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTH
FDQN

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

The Autophagy Receptor Tax1BP1 and the Molecular Motor Myosin Vi are Required for Clearance of Salmonella Typhimurium by Autophagy. Tumbarello, D.A., Manna, P.T., Allen, M. et al. PLoS Pathog (2015) 11:05174. DOI 10.1371/JOURNAL.PPAT.1005174 · PubMed

Other PDB entries of the same protein (UniProt Q86VP1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YT6 1.5 Å, Crystal structure of TAX1BP1 UBZ2 in complex with mono-ubiquitin
8W6A 1.53 Å, Crystal structure of TAX1BP1 LIR region in complex with GABARAP
4NLH 1.9 Å, SKICH domain of human TAX1BP1
4Z4M 2.15 Å, Crystal structure of GFP-TAX1BP1 UBZ2 domain fusion protein
5Z7G 2.3 Å, Crystal structure of TAX1BP1 SKICH region in complex with NAP1
8W6B 2.39 Å, crystal structure of TAX1BP1 SKICH domain in complex with RB1CC1 coiled-coil domain
4BMJ 2.75 Å, Structure of the UBZ1and2 tandem of the ubiquitin-binding adaptor protein TAX1BP1
4Z4K 2.8 Å, Crystal structure of GFP-TAX1BP1 UBZ1+2 domain fusion protein
2M7Q Solution structure of TAX1BP1 UBZ1+2

Browse structure collections

About this viewer

MolViewer shows 5AAS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.