4NLH: SKICH domain of human TAX1BP1

SKICH domain of human TAX1BP1. Determined by X-ray diffraction at 1.9 Å resolution. Released 24 Dec 2014.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,067
Mol. weight: 31.41 kDa
Released: 24 Dec 2014

Explore 4NLH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4NLH contains 8 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	17-20	4	1
β-strand	25-26	2	2
β-strand	32-38	7	1
β-strand	49-54	6	3
α-helix	60-62	3
β-strand	63-68	6	3
α-helix	70-72	3
β-strand	81-87	7	1
α-helix	89-91	3
β-strand	100-105	6	3
β-strand	111-114	4	3
α-helix	115-117	3
β-strand	118	1	3
β-strand	119-120	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tax1-binding protein 1	A, B	protein	138	Homo sapiens	Q86VP1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4NLH_1 Tax1-binding protein 1 (chains A, B)
GPSSPAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWS
PMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEEL
LTMEDEGNSDMLVVTTKA

Primary citation

SKICH domain of human TAX1BP1. Yang, Y., Wang, G., Huang, X. et al. To be published.

Other PDB entries of the same protein (UniProt Q86VP1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YT6 1.5 Å, Crystal structure of TAX1BP1 UBZ2 in complex with mono-ubiquitin
8W6A 1.53 Å, Crystal structure of TAX1BP1 LIR region in complex with GABARAP
4Z4M 2.15 Å, Crystal structure of GFP-TAX1BP1 UBZ2 domain fusion protein
5Z7G 2.3 Å, Crystal structure of TAX1BP1 SKICH region in complex with NAP1
8W6B 2.39 Å, crystal structure of TAX1BP1 SKICH domain in complex with RB1CC1 coiled-coil domain
4BMJ 2.75 Å, Structure of the UBZ1and2 tandem of the ubiquitin-binding adaptor protein TAX1BP1
4Z4K 2.8 Å, Crystal structure of GFP-TAX1BP1 UBZ1+2 domain fusion protein
2M7Q Solution structure of TAX1BP1 UBZ1+2
5AAS The selective autophagy receptor TAX1BP1 is required for autophagy- dependent capture of…

Browse structure collections

About this viewer

MolViewer shows 4NLH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.