2M8D: SRSF1 RRM2

Structure of SRSF1 RRM2 in complex with the RNA 5'-UGAAGGAC-3'. Determined by solution NMR. Released 10 Jul 2013.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 897
Mol. weight: 12.93 kDa
Released: 10 Jul 2013

Explore 2M8D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2M8D contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	122-126	5	1
α-helix	134-141	8
β-strand	147-152	6	1
β-strand	157-162	6	1
α-helix	165-171	7
β-strand	178-181	4	2
β-strand	187-190	4	2
β-strand	191-193	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA (5'-r(upgpapapgpgpapc)-3')	A	RNA	8
Serine/arginine-rich splicing factor 1	B	protein	91	Homo sapiens	Q07955 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2M8D_1 RNA (5'-R(*UP*GP*AP*AP*GP*GP*AP*C)-3') (chains A)
UGAAGGAC

Sequence of entity 2 (B), FASTA

>2M8D_2 Serine/arginine-rich splicing factor 1 (chains B)
MAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRK
EDMTYAVRKLDNTKFRSHEGETAYIRVKVDG

Primary citation

Isolated pseudo-RNA-recognition motifs of SR proteins can regulate splicing using a noncanonical mode of RNA recognition. Clery, A., Sinha, R., Anczukow, O. et al. Proc Natl Acad Sci U S A (2013) 110:E2802-E2811. DOI 10.1073/pnas.1303445110 · PubMed

Other PDB entries of the same protein (UniProt Q07955 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4C0O 2.56 Å, Transportin 3 in complex with phosphorylated ASF/SF2
3BEG 2.9 Å, Crystal structure of SR protein kinase 1 complexed to its substrate ASF/SF2
8QO9 5.29 Å, Cryo-EM structure of a human spliceosomal B complex protomer
7ABG 7.8 Å, Human pre-Bact-1 spliceosome
9R8V 8.5 Å, Cryo-EM structure of the human pre-Bact-OTS complex (whole map)
1X4A Solution structure of RRM domain in splicing factor SF2
2M7S NMR structure of RNA recognition motif 2 (RRM2) of Homo sapiens splicing factor,…
2O3D Structure of human SF2/ASF RNA recognition motif 2 (RRM2)
6HPJ Structure of human SRSF1 RRM1 bound to AACAAA RNA

Browse structure collections

About this viewer

MolViewer shows 2M8D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.