2MJC: PDB entry 2MJC

Zn-binding domain of eukaryotic translation initiation factor 3, subunit G. Determined by solution NMR. Released 7 Jan 2015.

Method

Solution NMR

Organism

Homo sapiens

Chains

1

Atoms

193

Mol. weight

3.88 kDa

Ligands

ZN

Released

7 Jan 2015

Explore 2MJC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MJC contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Molecules and chains

>2MJC_1 Eukaryotic translation initiation factor 3 subunit G (chains A)
PLGSKGQKIVSCRICKGDHWTTRCPYKDTLGPMQ

Ligands and cofactors

Primary citation

Solution NMR structure of the Zn-binding domain of eukaryotic translation initiation factor 3, subunit G. Al-Abdul-Wahid, M., Menade, M., Xie, J. et al. To be published.

Related structures

Other PDB entries of the same protein (UniProt O75821 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 8PPL 2.65 Å, MERS-CoV Nsp1 bound to the human 43S pre-initiation complex
• 8PJ5 2.9 Å, Structure of human 48S translation initiation complex after eIF2 release prior 60S…
• 8PJ6 2.9 Å, Structure of human 48S translation initiation complex with initiator tRNA, eIF1A and…
• 6YBS 3.1 Å, Structure of a human 48S translational initiation complex - head
• 8PJ4 3.2 Å, Structure of human 48S translation initiation complex after eIF5 release (48S-4)
• 8XXM 3.2 Å, Cryo-EM structure of the human 40S ribosome with PDCD4 and eIF3G
• 8PJ1 3.4 Å, Structure of human 48S translation initiation complex in open codon scanning state (48S-1)
• 8PJ2 3.4 Å, Structure of human 48S translation initiation complex in AUG recognition state after…
• 8OZ0 3.5 Å, Structure of a human 48S translation initiation complex with eIF4F and eIF4A
• 8XXN 3.6 Å, Cryo-EM structure of the human 43S ribosome with PDCD4
• 6ZMW 3.7 Å, Structure of a human 48S translational initiation complex
• 7QP7 3.7 Å, Structure of the human 48S initiation complex in closed state (h48S AUG closed)

Browse structure collections

About this viewer

MolViewer shows 2MJC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.