2MKF: E81 deletion mutant of the tandem UIMs of RAP80

Solution structure of the E81 deletion mutant of the tandem UIMs of RAP80. Determined by solution NMR. Released 19 Mar 2014.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 479
Mol. weight: 6.89 kDa
Released: 19 Mar 2014

Explore 2MKF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MKF contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	77-80	4
α-helix	82-94	13
α-helix	101-119	19
α-helix	121-125	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BRCA1-A complex subunit RAP80	A	protein	62	Homo sapiens	Q96RL1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MKF_1 BRCA1-A complex subunit RAP80 (chains A)
GPLGSRKIAQMTEEQFALALKMSEQEAREVNSQEEEEEELLRKAIAESLNSCRPSDASAT
RS

Primary citation

Molecular Basis for Impaired DNA Damage Response Function Associated with the RAP80 Delta E81 Defect. Anamika, Markin, C.J., Rout, M.K. et al. J Biol Chem (2014) 289:12852-12862. DOI 10.1074/jbc.M113.538280 · PubMed

Other PDB entries of the same protein (UniProt Q96RL1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9SQY 2.92 Å, Cryo-EM structure of the ARISC(E33A)-RAP80:K63-Ub7 complex (Composite map)
9SMP 3.0 Å, BRCA1-A complex bound to K63-polyUbATA - open form double State P
9SMN 3.2 Å, BRCA1-A complex bound to K63-polyUbATA - open form StateC StateP
9SNA 3.2 Å, BRCA1-A complex bound to K63-diUbATA - open form StateC StateP
9SMR 3.25 Å, Structure of apo BRCA1-A complex in presence of K63-oligoUbATA
9SMS 3.3 Å, BRCA1-A complex: Ubiquitin bound to BRE at the wrist site (focused 3D class)
9SO9 3.4 Å, BRCA1-A complex bound to K63-oligoUbATA - closed form StateC*
2MKG Solution structure of the tandem UIMs of RAP80
2N9E Structure of SUMO-2 bound to phosphorylated RAP80 SIM
2RR9 The solution structure of the K63-Ub2:tUIMs complex

Browse structure collections

About this viewer

MolViewer shows 2MKF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.