2MKG: Tandem UIMs of RAP80

Solution structure of the tandem UIMs of RAP80. Determined by solution NMR. Released 19 Mar 2014.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 488
Mol. weight: 7.02 kDa
Released: 19 Mar 2014

Explore 2MKG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MKG contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	-3--1	3
α-helix	0-80	8
α-helix	81-97	17
α-helix	102-118	17
α-helix	123-125	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BRCA1-A complex subunit RAP80	A	protein	63	Homo sapiens	Q96RL1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MKG_1 BRCA1-A complex subunit RAP80 (chains A)
GPLGSRKIAQMTEEEQFALALKMSEQEAREVNSQEEEEEELLRKAIAESLNSCRPSDASA
TRS

Primary citation

Molecular Basis for Impaired DNA Damage Response Function Associated with the RAP80 Delta E81 Defect. Anamika, Markin, C.J., Rout, M.K. et al. J Biol Chem (2014) 289:12852-12862. DOI 10.1074/jbc.M113.538280 · PubMed

Other PDB entries of the same protein (UniProt Q96RL1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9SQY 2.92 Å, Cryo-EM structure of the ARISC(E33A)-RAP80:K63-Ub7 complex (Composite map)
9SMP 3.0 Å, BRCA1-A complex bound to K63-polyUbATA - open form double State P
9SMN 3.2 Å, BRCA1-A complex bound to K63-polyUbATA - open form StateC StateP
9SNA 3.2 Å, BRCA1-A complex bound to K63-diUbATA - open form StateC StateP
9SMR 3.25 Å, Structure of apo BRCA1-A complex in presence of K63-oligoUbATA
9SMS 3.3 Å, BRCA1-A complex: Ubiquitin bound to BRE at the wrist site (focused 3D class)
9SO9 3.4 Å, BRCA1-A complex bound to K63-oligoUbATA - closed form StateC*
2MKF Solution structure of the E81 deletion mutant of the tandem UIMs of RAP80
2N9E Structure of SUMO-2 bound to phosphorylated RAP80 SIM
2RR9 The solution structure of the K63-Ub2:tUIMs complex

Browse structure collections

About this viewer

MolViewer shows 2MKG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.