2MP0: Phosphoenolpyruvate-protein phosphotransferase

Name: PDB 2MP0: Protein Phosphorylation upon a Fleeting Encounter
Published: 2014-08-20
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Protein Phosphorylation upon a Fleeting Encounter. Determined by solution NMR. Released 20 Aug 2014.

Method: Solution NMR
Organism: Escherichia coli
Chains: 2
Atoms: 3,039
Mol. weight: 46.44 kDa
Ligands: PO3
Released: 20 Aug 2014

Explore 2MP0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MP0 contains 17 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	1
β-strand	12-18	7	1
α-helix	22-25	4
α-helix	29-32	4
α-helix	33-64	32
α-helix	67-80	14
α-helix	83-91	9
α-helix	92-96	5
α-helix	100-116	17
α-helix	121-142	22
β-strand	156-160	5	1
α-helix	165-169	5
β-strand	176-181	6	1
α-helix	190-197	8
β-strand	201-202	2	1
β-strand	216-220	5	1
β-strand	227-229	3	1
α-helix	233-248	16

Chain B: 6 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	320-323	4	2
α-helix	324	1
β-strand	328-331	4	3
α-helix	333-335	3
α-helix	339-342	4
β-strand	348-354	7	3
β-strand	358-360	3	4
β-strand	365-370	6	3
β-strand	376-381	6	3
β-strand	386-390	5	3
β-strand	393	1	5
α-helix	395-398	4
β-strand	403-405	3	4
β-strand	412-413	2	3
β-strand	418-422	5	4
α-helix	424-430	7
β-strand	433	1	5
β-strand	436-440	5	3
α-helix	443-445	3
β-strand	449-451	3	2
β-strand	455-456	2	3
β-strand	462-466	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphoenolpyruvate-protein phosphotransferase	A	protein	258	Escherichia coli	P08839 (AlphaFold model)
Glucose-specific phosphotransferase enzyme IIA component	B	protein	168	Escherichia coli	P69783 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MP0_1 Phosphoenolpyruvate-protein phosphotransferase (chains A)
MISGILASPGIAFGKALLLKEDEIVIDRKKISADQVDQEVERFLSGRAKASAQLETIKTK
AGETFGEEKEAIFEGHIMLLEDEELEQEIIALIKDKHMTADAAAHEVIEGQASALEELDD
EYLKERAADVRDIGKRLLRNILGLKIIDLSAIQDEVILVAADLTPSETAQLNLKKVLGFI
TDAGGRTSHTSIMARSLELPAIVGTGSVTSQVKNDDYLILDAVNNQVYVNPTNEVIDKMR
AVQEQVASEKAELAKLKD

Sequence of entity 2 (B), FASTA

>2MP0_2 Glucose-specific phosphotransferase enzyme IIA component (chains B)
GLFDKLKSLVSDDKKDTGTIEIIAPLSGEIVNIEDVPDVVFAEKIVGDGIAIKPTGNKMV
APVDGTIGKIFETNHAFSIESDSGVELFVHFGIDTVELKGEGFKRIAEEGQRVKVGDTVI
EFDLPLLEEKAKSTLTPVVISNMDEIKELIKLSGSVTVGETPVIRIKK

Ligands and cofactors

ID	Name	Formula	Copies
PO3	Phosphite ion	O3 P	1

Primary citation

Visualizing an ultra-weak protein-protein interaction in phosphorylation signaling. Xing, Q., Huang, P., Yang, J. et al. Angew Chem Int Ed Engl (2014) 53:11501-11505. DOI 10.1002/anie.201405976 · PubMed

Other PDB entries of the same protein (UniProt P08839 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6V9K 1.9 Å, Crystal structure of the hybrid C-terminal domain of enzyme I of the bacterial…
1ZYM 2.5 Å, Amino terminal domain of enzyme I from escherichia coli
2HWG 2.7 Å, Structure of phosphorylated Enzyme I of the phosphoenolpyruvate:sugar phosphotransferase…
6VU0 3.5 Å, Crystal structure of the C-terminal domain of enzyme I of the bacterial…
1EZA Amino terminal domain of enzyme I from escherichia coli NMR, restrained regularized mean…
1EZB Amino terminal domain of enzyme I from escherichia coli, NMR, 17 structures
1EZC Amino terminal domain of enzyme I from escherichia coli, NMR, 17 structures
1EZD Amino terminal domain of enzyme I from escherichia coli NMR, 16 structures
2EZA Amino terminal domain of enzyme I from escherichia coli, NMR, restrained regularized…
2EZB Amino terminal domain of enzyme I from escherichia coli, NMR, 14 structures
2EZC Amino terminal domain of enzyme I from escherichia coli, NMR, 14 structures
2KX9 Solution Structure of the Enzyme I dimer Using Residual Dipolar Couplings and Small…

Browse structure collections

About this viewer

MolViewer shows 2MP0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.