2MPH: Human FK506 binding Protein 25

Solution Structure of human FK506 binding Protein 25. Determined by solution NMR. Released 20 May 2015.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,775
Mol. weight: 25.22 kDa
Released: 20 May 2015

Explore 2MPH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MPH contains 12 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
α-helix	12-15	4
α-helix	22-32	11
β-strand	33	1	1
α-helix	35-41	7
α-helix	47-53	7
α-helix	56-68	13
β-strand	72	1	1
β-strand	111-117	7	2
α-helix	124-126	3
β-strand	132-138	7	2
β-strand	144-147	4	2
α-helix	150-152	3
α-helix	161	1
β-strand	162-163	2	2
α-helix	173-179	7
β-strand	187-192	6	2
α-helix	194-196	3
β-strand	203	1	3
α-helix	204-206	3
β-strand	208	1	3
β-strand	214-222	9	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peptidyl-prolyl cis-trans isomerase FKBP3	A	protein	224	Homo sapiens	Q00688 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MPH_1 Peptidyl-prolyl cis-trans isomerase FKBP3 (chains A)
MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLV
TAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGD
KTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALL
TMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID

Primary citation

Structural basis of nucleic acid recognition by FK506-binding protein 25 (FKBP25), a nuclear immunophilin. Prakash, A., Shin, J., Rajan, S. et al. Nucleic Acids Res (2016) 44:2909-2925. DOI 10.1093/nar/gkw001 · PubMed

Other PDB entries of the same protein (UniProt Q00688 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GPG 1.67 Å, Co-crystal structure of the FK506 binding domain of human FKBP25, Rapamycin and the FRB…
5D75 1.83 Å, Crystal structure of Human FKBD25 in complex with FK506
1PBK 2.5 Å, Homologous domain of human FKBP25
2KFV Structure of the amino-terminal domain of human FK506-binding protein 3 / Northeast…

Browse structure collections

About this viewer

MolViewer shows 2MPH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.