2MPT: WW3 domain of Nedd4L

Name: PDB 2MPT: WW3 domain of Nedd4L in complex with its HECT domain PY motif
Published: 2014-10-22
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

WW3 domain of Nedd4L in complex with its HECT domain PY motif. Determined by solution NMR. Released 22 Oct 2014.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 385
Mol. weight: 7.27 kDa
Released: 22 Oct 2014

Explore 2MPT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MPT contains 1 α-helix and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	483-487	5	1
β-strand	493-497	5	1
β-strand	502-504	3	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	926-931	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase NEDD4-like	A	protein	48	Homo sapiens	Q96PU5 (AlphaFold model)
E3 ubiquitin-protein ligase NEDD4-like	B	protein	14	Homo sapiens	Q96PU5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MPT_1 E3 ubiquitin-protein ligase NEDD4-like (chains A)
GAMEQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVHMRSK

Sequence of entity 2 (B), FASTA

>2MPT_2 E3 ubiquitin-protein ligase NEDD4-like (chains B)
RLDLPPYETFEDLX

Primary citation

Structural Basis of the Activation and Degradation Mechanisms of the E3 Ubiquitin Ligase Nedd4L. Escobedo, A., Gomes, T., Aragon, E. et al. Structure (2014) 22:1446-1457. DOI 10.1016/j.str.2014.08.016 · PubMed

Other PDB entries of the same protein (UniProt Q96PU5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LP1 1.35 Å, Structure of Nedd4L WW3 domain
7LP3 1.61 Å, Structure of Nedd4L WW3 domain
6ZBT 1.8 Å, Structure of 14-3-3 gamma in complex with Nedd4-2 14-3-3 binding motif Ser342
2NSQ 1.85 Å, Crystal structure of the C2 domain of the human E3 ubiquitin-protein ligase NEDD4-like…
7LP2 1.88 Å, Structure of Nedd4L WW3 domain
6ZC9 1.9 Å, Structure of 14-3-3 gamma in complex with Nedd4-2 14-3-3 binding motif Ser448
2ONI 2.2 Å, Catalytic Domain of the Human NEDD4-like E3 Ligase
7NMZ 2.3 Å, Structure of 14-3-3 eta in complex with Nedd4-2(335-455) containing two 14-3-3 binding…
5HPK 2.43 Å, System-wide modulation of HECT E3 ligases with selective ubiquitin variant probes:…
9Z5Q 3.06 Å, HECT domain of NEDD4-2 complex with a targeted nanobody, nb.C11
3JW0 3.1 Å, E2~Ubiquitin-HECT
3JVZ 3.3 Å, E2~Ubiquitin-HECT

Browse structure collections

About this viewer

MolViewer shows 2MPT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.