2MVW: Protein PML

Solution structure of the TRIM19 B-box1 (B1) of human promyelocytic leukemia (PML). Determined by solution NMR. Released 12 Nov 2014.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 832
Mol. weight: 12.15 kDa
Ligands: ZN
Released: 12 Nov 2014

Explore 2MVW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MVW contains 2 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 1 helix, 3 β-strands

Element	Residues	Length	Sheet
β-strand	136-140	5	1
β-strand	146-148	3	1
α-helix	149-158	10
β-strand	163-165	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein PML	A, B	protein	51	Homo sapiens	P29590 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2MVW_1 Protein PML (chains A, B)
GSRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAE

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

The B-box 1 dimer of human promyelocytic leukemia protein. Huang, S.Y., Naik, M.T., Chang, C.F. et al. J Biomol NMR (2014) 60:275-281. DOI 10.1007/s10858-014-9869-4 · PubMed

Other PDB entries of the same protein (UniProt P29590 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6UYR 1.3 Å, Crystal structure of K46-acetylated SUMO1 in complex with PML-SIM
6UYV 1.4 Å, Crystal structure of K46-acetylated SUMO1 in complex with phosphorylated PML-SIM
6UYP 1.42 Å, Crystal structure of K39-acetylated SUMO1 in complex with PML-SIM
4WJO 1.46 Å, Crystal Structure of SUMO1 in complex with PML
4WJN 1.5 Å, Crystal structure of SUMO1 in complex with phosphorylated PML
6UYQ 1.5 Å, Crystal structure of K45-acetylated SUMO1 in complex with PML-SIM
6UYS 1.59 Å, Crystal structure of K37-acetylated SUMO1 in complex with phosphorylated PML-SIM
5YUF 1.6 Å, Crystal Structure of PML RING tetramer
6UYO 1.64 Å, Crystal structure of K37-acetylated SUMO1 in complex with PML-SIM
6UYU 1.66 Å, Crystal structure of K45-acetylated SUMO1 in complex with phosphorylated PML-SIM
6UYT 1.66 Å, Crystal structure of K39-acetylated SUMO1 in complex with phosphorylated PML-SIM
8DJH 1.77 Å, Ternary complex of SUMO1 with a phosphomimetic SIM of PML and zinc

Browse structure collections

About this viewer

MolViewer shows 2MVW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.