2N0A: Alpha-synuclein

Atomic-resolution structure of alpha-synuclein fibrils. Determined by solid-state NMR. Released 23 Mar 2016.

Method: Solid-state NMR
Organism: Homo sapiens
Chains: 10
Atoms: 10,130
Mol. weight: 144.76 kDa
Released: 23 Mar 2016

Explore 2N0A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2N0A contains 13 α-helices and 70 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
α-helix	17-19	3
α-helix	26-27	2
β-strand	30	1	1
β-strand	35	1	2
β-strand	38-55	18	3
β-strand	61-66	6	4
β-strand	70-78	9	5
β-strand	81-83	3	6
β-strand	88-97	10	7
α-helix	107-112	6
α-helix	128-132	5

Chain B: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
α-helix	12-13	2
β-strand	30	1	1
β-strand	35	1	2
β-strand	38-55	18	3
β-strand	61-66	6	4
β-strand	70-78	9	5
β-strand	81-83	3	6
β-strand	88-97	10	7

Chain C: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	13-15	3
β-strand	30	1	1
β-strand	35	1	2
β-strand	38-55	18	3
β-strand	61-66	6	4
β-strand	70-78	9	5
β-strand	81-83	3	6
β-strand	88-97	10	7
α-helix	112-114	3

Chain D: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	30	1	1
β-strand	35	1	2
β-strand	38-55	18	3
β-strand	61-66	6	4
β-strand	70-78	9	5
β-strand	81-83	3	6
β-strand	88-97	10	7
α-helix	127-129	3

Chain E: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	30	1	1
β-strand	35	1	2
β-strand	38-55	18	3
β-strand	61-66	6	4
β-strand	70-78	9	5
β-strand	81-83	3	6
β-strand	88-97	10	7
α-helix	107-109	3

Chain F: 0 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	28-30	3	1
β-strand	35	1	2
β-strand	38-55	18	3
β-strand	61-66	6	4
β-strand	70-78	9	5
β-strand	81-83	3	6
β-strand	88-97	10	7

Chain G: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	28-30	3	1
β-strand	35	1	2
β-strand	38-55	18	3
β-strand	61-66	6	4
β-strand	70-78	9	5
β-strand	81-83	3	6
β-strand	88-97	10	7
α-helix	123-125	3

Chain H: 0 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	29-30	2	1
β-strand	35	1	2
β-strand	38-55	18	3
β-strand	61-66	6	4
β-strand	70-78	9	5
β-strand	81-83	3	6
β-strand	88-98	11	7

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-synuclein	A, B, C, D, E, F, G, H, I, J	protein	140	Homo sapiens	P37840 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J), FASTA

>2N0A_1 Alpha-synuclein (chains A, B, C, D, E, F, G, H, I, J)
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA

Primary citation

Solid-state NMR structure of a pathogenic fibril of full-length human alpha-synuclein. Tuttle, M.D., Comellas, G., Nieuwkoop, A.J. et al. Nat Struct Mol Biol (2016) 23:409-415. DOI 10.1038/nsmb.3194 · PubMed

Other PDB entries of the same protein (UniProt P37840 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8JJV 1.23 Å, Structure of truncated form of nanobody in complex with alpha-synuclein peptide
8JLY 1.29 Å, Structure of nanobody in complex with alpha-synuclein peptide
3Q27 1.3 Å, Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (MBP)
4R0U 1.38 Å, Tgvtava, an amyloid forming segment from alpha synuclein, residues 72-78
6I42 1.38 Å, Structure of the alpha-Synuclein PreNAC/Cyclophilin A-complex
4ZNN 1.41 Å, MicroED structure of the segment, GVVHGVTTVA, from the A53T familial mutant of…
4RIL 1.43 Å, Structure of the amyloid forming segment, GAVVTGVTAVA, from the NAC domain of…
4R0W 1.5 Å, Vvtgvta, an amyloid forming segment from alpha synuclein, residues 70-76
3Q26 1.54 Å, Cyrstal structure of human alpha-synuclein (10-42) fused to maltose binding protein (MBP)
3Q28 1.6 Å, Cyrstal structure of human alpha-synuclein (58-79) fused to maltose binding protein (MBP)
5CRW 1.6 Å, Crystal structure of the b'-a' domain of oxidized protein disulfide isomerase complexed…
2X6M 1.62 Å, Structure of a single domain camelid antibody fragment in complex with a C-terminal…

Browse more

2N0A is part of these collections:

Protein folding, misfolding and amyloid

About this viewer

MolViewer shows 2N0A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.