2N1L: BCOR PUFD

Solution structure of the BCOR PUFD. Determined by solution NMR. Released 6 Apr 2016.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 927
Mol. weight: 13.11 kDa
Released: 6 Apr 2016

Explore 2N1L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2N1L contains 5 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	33-35	3	1
α-helix	36-43	8
α-helix	47-53	7
β-strand	59-60	2	1
α-helix	64-74	11
α-helix	81-85	5
β-strand	96-98	3	1
α-helix	101-106	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BCL-6 corepressor	A	protein	115	Homo sapiens	Q6W2J9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2N1L_1 BCL-6 corepressor (chains A)
SDVFEFEFSETPLLPSYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIFRSNFPNVEIVTIA
EAEFYRQVSASLLFSSSKDLEAFNPESKELLDLVEFTNEIQTLLGSSVEWLHPSD

Primary citation

Structural basis for the hierarchical assembly of the core of PRC1.1. Wong, S.J., Gearhart, M.D., Ha, D.J. et al. To be published.

Other PDB entries of the same protein (UniProt Q6W2J9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HPL 2.0 Å, PCGF1 Ub fold (RAWUL)/BCOR PUFD Complex
8HCU 2.2 Å, Crystal structure of BCOR/PCGF1/KDM2B complex
3BIM 2.6 Å, Crystal structure of the BCL6 BTB domain dimer in complex with the BCOR BBD corepressor…
6B7G Solution NMR structure of BCoR in complex with AF9 (BCoR-AF9)

Browse structure collections

About this viewer

MolViewer shows 2N1L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.