2N5E: Discoidal high-density lipoprotein particles

The 3D solution structure of discoidal high-density lipoprotein particles. Determined by solution NMR. Released 21 Dec 2016.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 2,736
Mol. weight: 38.92 kDa
Released: 21 Dec 2016

Explore 2N5E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2N5E contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	58-64	7
α-helix	67-79	13
α-helix	81-118	38
α-helix	119-145	5
α-helix	146-241	96

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apolipoprotein A-I	A, B	protein	167	Homo sapiens	P02647 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2N5E_1 Apolipoprotein A-I (chains A, B)
STFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMEL
YRQKVEPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKA
TEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

Primary citation

Solution structure of discoidal high-density lipoprotein particles with a shortened apolipoprotein A-I. Bibow, S., Polyhach, Y., Eichmann, C. et al. Nat Struct Mol Biol (2017) 24:187-193. DOI 10.1038/nsmb.3345 · PubMed

Other PDB entries of the same protein (UniProt P02647 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7KJR 2.08 Å, Cryo-EM structure of SARS-CoV-2 ORF3a
9PVY 2.15 Å, Cryo-EM structure of cardiac amyloid fibril from a variant apolipoprotein A-I L90P…
3R2P 2.2 Å, 2.2 Angstrom Crystal Structure of C Terminal Truncated Human Apolipoprotein A-I Reveals…
9PVZ 2.3 Å, Cryo-EM structure of cardiac amyloid fibril from a variant apolipoprotein A-I R173P…
8VXJ 2.7 Å, The crystal structure of human apolipoprotein A-I in complex with Fab 55201
9PW3 2.73 Å, Cryo-EM structure of renal amyloid fibril from a variant apolipoprotein A-I R173P…
8EQS 3.1 Å, Structure of SARS-CoV-1 Orf3a in late endosome/lysosome-like environment, MSP1D1 nanodisc
1AV1 4.0 Å, Crystal structure of human apolipoprotein a-I
4V6M 7.1 Å, Structure of the ribosome-SecYE complex in the membrane environment
9MXZ 9.8 Å, Lecithin:Cholesterol Acyltransferase Bound to Apolipoprotein A-I dimer in HDL
1GW3 The helix-hinge-helix structural motif in human apolipoprotein a-I determined by NMR…
1GW4 The helix-hinge-helix structural motif in human apolipoprotein a-I determined by NMR…

Browse structure collections

About this viewer

MolViewer shows 2N5E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.