2N83: P75NTR DD:RIP2 card

p75NTR DD:RIP2 card. Determined by solution NMR. Released 23 Dec 2015.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,556
Mol. weight: 22.65 kDa
Released: 23 Dec 2015

Explore 2N83 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2N83 contains 13 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	335	1	1
α-helix	336-338	3
α-helix	341-354	14
α-helix	358-366	9
α-helix	370-376	7
α-helix	382-391	10
β-strand	397	1	1
α-helix	398-408	11
α-helix	411-419	9

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	436-442	7
α-helix	444-450	7
α-helix	454-464	11
α-helix	471-479	9
α-helix	483-497	15
α-helix	500-512	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor receptor superfamily member 16	A	protein	98	Homo sapiens	P08138 (AlphaFold model)
Receptor-interacting serine/threonine-protein kinase 2	B	protein	106	Homo sapiens	O43353 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2N83_1 Tumor necrosis factor receptor superfamily member 16 (chains A)
KGDGGLYSSLPPAKREEVEKLLNGSAGDTWRHLAGELGYQPEHIDSFTHEACPVRALLAS
WATQDSATLDALLAALRRIQRADLVESLCSESTATSPV

Sequence of entity 2 (B), FASTA

>2N83_2 Receptor-interacting serine/threonine-protein kinase 2 (chains B)
GIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDT
TDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKS

Primary citation

Structural basis of death domain signaling in the p75 neurotrophin receptor. Lin, Z., Tann, J.Y., Goh, E.T. et al. Elife (2015) 4:11692-11692. DOI 10.7554/eLife.11692 · PubMed

Other PDB entries of the same protein (UniProt P08138 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EWV 2.6 Å, Crystal Structure of calmodulin complexed with a peptide
2N80 p75NTR DD:RhoGDI
2N97 DD homodimer
5ZGG NMR structure of p75NTR transmembrane domain in complex with NSC49652
7CSQ Solution structure of the complex between p75NTR-DD and TRADD-DD
8X8T NMR structure of p75NTR juxtamembrane domain in complex with RhoGDI N-terminal domain…

Browse structure collections

About this viewer

MolViewer shows 2N83 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.