NMR structure of p75NTR transmembrane domain in complex with NSC49652. Determined by solution NMR. Released 13 Mar 2019.
Explore 5ZGG in 3D Show helices and sheets RCSB PDB PDBe
5ZGG contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 252-276 | 25 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tumor necrosis factor receptor superfamily member 16 | A, B | protein | 34 | Homo sapiens | P08138 (AlphaFold model) |
>5ZGG_1 Tumor necrosis factor receptor superfamily member 16 (chains A, B) TRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNS
| ID | Name | Formula | Copies |
|---|---|---|---|
| 9F6 | (2E)-1-(2-hydroxyphenyl)-3-(pyridin-3-yl)prop-2-en-1-one | C14 H11 N O2 | 1 |
A Small Molecule Targeting the Transmembrane Domain of Death Receptor p75NTRInduces Melanoma Cell Death and Reduces Tumor Growth. Goh, E.T.H., Lin, Z., Ahn, B.Y. et al. Cell Chem Biol (2018) 25:1485-1494.e5. DOI 10.1016/j.chembiol.2018.09.007 · PubMed
Other PDB entries of the same protein (UniProt P08138 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5ZGG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.