Solution NMR Structure of the membrane localization domain from the Ras/Rap1-specific endopeptidase (RRSP) of the Vibrio vulnificus multifunctional autoprocessing repeats-in-toxins (MARTX) toxin. Determined by solution NMR. Released 7 Dec 2016.
Explore 2N9W in 3D Show helices and sheets RCSB PDB PDBe
2N9W contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-6 | 2 | |
| α-helix | 7-15 | 9 | |
| α-helix | 24-26 | 3 | |
| α-helix | 27-34 | 8 | |
| α-helix | 41-60 | 20 | |
| α-helix | 66-76 | 11 | |
| α-helix | 79-81 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| RTX toxin | A | protein | 90 | Vibrio vulnificus | A0A2S3R7M0 |
>2N9W_1 RTX toxin (chains A) MGQIFTVQELKERAKVFAKPIGASYQGILDQLDLVHQAKGRDQIAASFELNKKINDYIAE HPTSGRNQALTQLKEQVTSALGLEHHHHHH
The membrane localization domains of two distinct bacterial toxins form a 4-helix-bundle in solution. Hisao, G.S., Brothers, M.C., Ho, M. et al. Protein Sci (2017) 26:497-504. DOI 10.1002/pro.3097 · PubMed
Other PDB entries of the same protein (UniProt A0A2S3R7M0), best resolution first:
MolViewer shows 2N9W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.