8YJA: MARTX cysteine protease domain

Structure of Vibrio vulnificus MARTX cysteine protease domain lacking beta-flap. Determined by X-ray diffraction at 2.2 Å resolution. Released 10 Jul 2024.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Vibrio vulnificus MO6-24/O
Chains: 2
Atoms: 2,744
Mol. weight: 46.04 kDa
Ligands: IHP
Released: 10 Jul 2024

Explore 8YJA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8YJA contains 12 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	3598-3600	3
α-helix	3602-3603	2
β-strand	3619-3624	6	1
α-helix	3629-3641	13
β-strand	3646-3651	6	1
β-strand	3657-3661	5	1
α-helix	3664-3666	3
β-strand	3671-3677	7	1
β-strand	3679-3684	6	2
β-strand	3687-3690	4	2
β-strand	3693	1	2
α-helix	3695-3713	19
β-strand	3721-3726	6	1
α-helix	3732-3748	17
β-strand	3754-3759	6	1

Chain B: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	3598-3600	3
α-helix	3604-3606	3
β-strand	3619-3624	6	1
α-helix	3629-3641	13
β-strand	3646-3651	6	1
β-strand	3657-3661	5	1
α-helix	3664-3666	3
β-strand	3671-3677	7	1
β-strand	3679-3681	3	3
β-strand	3688-3690	3	3
β-strand	3693	1	3
α-helix	3695-3713	19
β-strand	3721-3726	6	1
α-helix	3732-3748	17
β-strand	3754-3759	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MARTX cysteine protease domain	A, B	protein	208	Vibrio vulnificus MO6-24/O	A0A2S3R7M0

Sequence of entity 1 (A, B), FASTA

>8YJA_1 MARTX cysteine protease domain (chains A, B)
GSAMGSILHNQNVNDWERVVVTPTADGGESRFDGQIIVQMENDDVVAKAAANLAGKHPES
SVVVQIDSDGNYRVVYGDPSKLDGKLRWQLVGHGRDDSESNNTRLSGYSADELAVKLAKF
QQSFNQAENINNKPDHISIVGCSLVSDDKQKGFGHQFINAMDANGLRVDVSVRSSELAVD
EAGRKHTKDANGDWVQKAENNKVSLSWD

Ligands and cofactors

ID	Name	Formula	Copies
IHP	Inositol hexakisphosphate	C6 H18 O24 P6	1

Water and common crystallization additives (NA) are not listed.

Primary citation

Structural basis of the activation of MARTX cysteine protease domain from Vibrio vulnificus. Chen, L., Khan, H., Tan, L. et al. PLoS One (2024) 19:e0307512-e0307512. DOI 10.1371/journal.pone.0307512 · PubMed

Other PDB entries of the same protein (UniProt A0A2S3R7M0), best resolution first:

8YJC 1.3 Å, Structure of Vibrio vulnificus MARTX cysteine protease domain C3727A
8KA0 2.35 Å, Crystal structure of Vibrio vulnificus RID-dependent transforming NADase domain…
5XN7 2.7 Å, Crystal structure of the effector domain RID of Vibrio vulnificus MARTX toxin
8KA1 2.82 Å, Crystal structure of Vibrio vulnificus RID-dependent transforming NADase domain…
8K9Z 2.9 Å, Crystal structure of Vibrio vulnificus RID-dependent transforming NADase domain…
8KA2 3.38 Å, Crystal structure of the RID-dependent transforming NADase domain…
2N9W Solution NMR Structure of the membrane localization domain from the Ras/Rap1-specific…

Browse structure collections

About this viewer

MolViewer shows 8YJA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.