Crystal structure of the RID-dependent transforming NADase domain (RDTND)/calmodulin-binding domain of Rho inactivation domain (RID-CBD) from Vibrio vulnificus. Determined by X-ray diffraction at 3.38 Å resolution. Released 10 Jul 2024.
Explore 8KA2 in 3D Show helices and sheets RCSB PDB PDBe
8KA2 contains 36 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1969-1985 | 17 | |
| α-helix | 1986-1988 | 3 | |
| α-helix | 2011-2025 | 15 | |
| α-helix | 2042-2048 | 7 | |
| α-helix | 2053-2061 | 9 | |
| β-strand | 2076 | 1 | 1 |
| α-helix | 2088-2097 | 10 | |
| β-strand | 2105 | 1 | 1 |
| α-helix | 2107-2109 | 3 | |
| α-helix | 2113-2127 | 15 | |
| α-helix | 2139-2162 | 24 | |
| α-helix | 2166-2168 | 3 | |
| β-strand | 2169-2171 | 3 | 2 |
| α-helix | 2181 | 1 | |
| α-helix | 2182-2186 | 5 | |
| α-helix | 2187-2195 | 9 | |
| β-strand | 2203-2205 | 3 | 2 |
| α-helix | 2209-2211 | 3 | |
| α-helix | 2217-2219 | 3 | |
| β-strand | 2222-2223 | 2 | 2 |
| β-strand | 2228-2234 | 7 | 3 |
| α-helix | 2235-2237 | 3 | |
| α-helix | 2241-2248 | 8 | |
| β-strand | 2259-2265 | 7 | 3 |
| α-helix | 2266-2271 | 6 | |
| α-helix | 2280-2285 | 6 | |
| β-strand | 2288-2289 | 2 | 4 |
| β-strand | 2292 | 1 | 5 |
| β-strand | 2297-2299 | 3 | 5 |
| β-strand | 2300-2301 | 2 | 4 |
| β-strand | 2310-2314 | 5 | 5 |
| α-helix | 2320-2332 | 13 | |
| β-strand | 2343-2347 | 5 | 5 |
| β-strand | 2350-2352 | 3 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1969-1983 | 15 | |
| α-helix | 2013-2024 | 12 | |
| α-helix | 2037-2048 | 12 | |
| α-helix | 2052-2063 | 12 | |
| β-strand | 2076 | 1 | 6 |
| α-helix | 2089-2097 | 9 | |
| β-strand | 2105 | 1 | 6 |
| α-helix | 2107-2109 | 3 | |
| α-helix | 2111-2129 | 19 | |
| α-helix | 2133-2135 | 3 | |
| α-helix | 2138-2163 | 26 | |
| β-strand | 2168 | 1 | 7 |
| β-strand | 2171 | 1 | 8 |
| α-helix | 2181 | 1 | |
| α-helix | 2182-2186 | 5 | |
| α-helix | 2187-2195 | 9 | |
| β-strand | 2202 | 1 | 7 |
| β-strand | 2205 | 1 | 8 |
| α-helix | 2267-2276 | 10 | |
| α-helix | 2280-2285 | 6 | |
| β-strand | 2288-2292 | 5 | 9 |
| β-strand | 2297-2301 | 5 | 9 |
| α-helix | 2309 | 1 | |
| β-strand | 2310-2314 | 5 | 9 |
| α-helix | 2320-2333 | 14 | |
| β-strand | 2343-2347 | 5 | 9 |
| β-strand | 2350-2353 | 4 | 9 |
| β-strand | 2354 | 1 | 10 |
| β-strand | 2358 | 1 | 10 |
| β-strand | 2362 | 1 | 9 |
| β-strand | 2370 | 1 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Rdtnd-rid cbd | A, B | protein | 419 | Vibrio vulnificus | A0A2S3R7M0 |
>8KA2_1 RDTND-RID CBD (chains A, B) GAMGEASHDSAESLVAARAEKVANLYRWLDTDNDVATDKYVPVPGFERVDVDVSDEVKQR MIQSMSGYIEHTDNQVPKDQAEALATLFVESTLDYDWDKRVEFLTKLESYGYSFEAPHAE KSIVSFWSGKNFKQYRDILDNAQTDGKKVVYDIDVKGNAFAIDLNKHLMRWGGLFLDPDN AEQNQLKSSIDAATFSNTGFWSSVYATGAQNDVYVIAEGGVRLGNYFWNVELPALRQLQR EGLVGEIRLLDKPVSEYKDLPADQIGRRLTDAGVAVKVRFDALSHERQAELLADNPDGYK ADTLVELDVKLSAIDSMLRESLPFYSLRTERNLLVQEGEEGFEVRSWPGIDGKSKTILLD NPEDAAQQKSIERFILANFDNFEQMPDELFLVDNKVLSHHDGRTRIIAQKEDGAWTYNT
Dissemination of pathogenic bacteria is reinforced by a MARTX toxin effector duet. Choi, S., Lee, Y., Park, S. et al. Nat Commun (2024) 15:6218-6218. DOI 10.1038/s41467-024-50650-0 · PubMed
Other PDB entries of the same protein (UniProt A0A2S3R7M0), best resolution first:
MolViewer shows 8KA2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.