2NAJ: K2 lobe of double-knot toxin

Name: PDB 2NAJ: Solution structure of K2 lobe of double-knot toxin
Published: 2016-03-02
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Solution structure of K2 lobe of double-knot toxin. Determined by solution NMR. Released 2 Mar 2016.

Method: Solution NMR
Organism: Haplopelma schmidti
Chains: 1
Atoms: 253
Mol. weight: 3.69 kDa
Released: 2 Mar 2016

Explore 2NAJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2NAJ contains 0 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	1
β-strand	9	1	2
β-strand	13	1	2
β-strand	19-20	2	3
β-strand	28	1	1
β-strand	30-31	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tau-theraphotoxin-Hs1a	A	protein	33	Haplopelma schmidti	P0CH43 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2NAJ_1 Tau-theraphotoxin-Hs1a (chains A)
NCAKEGEVCGWGSKCCHGLDCPLAFIPYCEKYR

Primary citation

Structural insights into the mechanism of activation of the TRPV1 channel by a membrane-bound tarantula toxin. Bae, C., Anselmi, C., Kalia, J. et al. Elife (2016) 5. DOI 10.7554/eLife.11273 · PubMed

Other PDB entries of the same protein (UniProt P0CH43 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5IRX 2.95 Å, Structure of TRPV1 in complex with DkTx and RTX, determined in lipid nanodisc
7L2T 3.08 Å, cryo-EM structure of DkTx-bound minimal TRPV1 in partial open state
7L2R 3.3 Å, Cryo-EM structure of DkTx-bound minimal TRPV1 at the pre-open state
7L2U 3.47 Å, cryo-EM structure of DkTx-bound minimal TRPV1 in open state
7L2M 3.84 Å, Cryo-EM structure of DkTx/RTX-bound full-length TRPV1
2N9Z Solution structure of K1 lobe of double-knot toxin
6CUC Solution structure of double knot toxin (DkTx)

Browse structure collections

About this viewer

MolViewer shows 2NAJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.