Solution structure of K2 lobe of double-knot toxin. Determined by solution NMR. Released 2 Mar 2016.
Explore 2NAJ in 3D Show helices and sheets RCSB PDB PDBe
2NAJ contains 0 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8 | 1 | 1 |
| β-strand | 9 | 1 | 2 |
| β-strand | 13 | 1 | 2 |
| β-strand | 19-20 | 2 | 3 |
| β-strand | 28 | 1 | 1 |
| β-strand | 30-31 | 2 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tau-theraphotoxin-Hs1a | A | protein | 33 | Haplopelma schmidti | P0CH43 (AlphaFold model) |
>2NAJ_1 Tau-theraphotoxin-Hs1a (chains A) NCAKEGEVCGWGSKCCHGLDCPLAFIPYCEKYR
Structural insights into the mechanism of activation of the TRPV1 channel by a membrane-bound tarantula toxin. Bae, C., Anselmi, C., Kalia, J. et al. Elife (2016) 5. DOI 10.7554/eLife.11273 · PubMed
Other PDB entries of the same protein (UniProt P0CH43 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2NAJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.