6CUC: Double knot toxin

Name: PDB 6CUC: Solution structure of double knot toxin (DkTx)
Published: 2019-03-27
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Solution structure of double knot toxin (DkTx). Determined by solution NMR. Released 27 Mar 2019.

Method: Solution NMR
Organism: Haplopelma schmidti
Chains: 1
Atoms: 611
Mol. weight: 9.29 kDa
Released: 27 Mar 2019

Explore 6CUC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6CUC contains 2 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	1
β-strand	9	1	2
β-strand	16	1	1
β-strand	22	1	3
β-strand	31	1	2
β-strand	34	1	3
α-helix	35-45	11
β-strand	48	1	4
β-strand	53	1	5
β-strand	60	1	4
α-helix	61	1
β-strand	64-65	2	6
β-strand	73	1	5
β-strand	75-76	2	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tau-theraphotoxin-Hs1a	A	protein	82	Haplopelma schmidti	P0CH43 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6CUC_1 Tau-theraphotoxin-Hs1a (chains A)
GDCAKEGEVCSWGKKCCDLDNFYCPMEFIPHCKKYKPYVPVTTSFNCAKEGEVCGWGSKC
CHGLDCPLAFIPYCEKYRGRND

Primary citation

Structural Basis of the Bivalency of the TRPV1 Agonist DkTx. Ramanujam, V., Crawford, T., Cristofori-Armstrong, B. et al. Angew Chem Int Ed Engl (2024) 63:e202314621-e202314621. DOI 10.1002/anie.202314621 · PubMed

Other PDB entries of the same protein (UniProt P0CH43 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5IRX 2.95 Å, Structure of TRPV1 in complex with DkTx and RTX, determined in lipid nanodisc
7L2T 3.08 Å, cryo-EM structure of DkTx-bound minimal TRPV1 in partial open state
7L2R 3.3 Å, Cryo-EM structure of DkTx-bound minimal TRPV1 at the pre-open state
7L2U 3.47 Å, cryo-EM structure of DkTx-bound minimal TRPV1 in open state
7L2M 3.84 Å, Cryo-EM structure of DkTx/RTX-bound full-length TRPV1
2N9Z Solution structure of K1 lobe of double-knot toxin
2NAJ Solution structure of K2 lobe of double-knot toxin

Browse structure collections

About this viewer

MolViewer shows 6CUC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.