2NCN: Autophagy-Related Protein LC3C

Solution Structure of the Autophagy-Related Protein LC3C. Determined by solution NMR. Released 19 Apr 2017.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,040
Mol. weight: 14.8 kDa
Released: 19 Apr 2017

Explore 2NCN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2NCN contains 4 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
α-helix	19-32	14
β-strand	36-43	8	1
β-strand	57-61	5	1
β-strand	65	1	2
α-helix	66-75	10
β-strand	86-89	4	1
β-strand	93	1	1
β-strand	100	1	2
α-helix	101-108	8
β-strand	115-120	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Autophagy-Related Protein LC3C	A	protein	128	Homo sapiens	Q9BXW4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2NCN_1 Autophagy-Related Protein LC3C (chains A)
GSMPPPQKIPSVRPFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKF
LVPQELTMTQFLSIIRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMT
YASQETFG

Primary citation

Solution structure of the autophagy-related protein LC3C reveals a polyproline II motif on a mobile tether with phosphorylation site. Krichel, C., Mockel, C., Schillinger, O. et al. Sci Rep (2019) 9:14167-14167. DOI 10.1038/s41598-019-48155-8 · PubMed

Other PDB entries of the same protein (UniProt Q9BXW4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3WAM 1.75 Å, Crystal structure of human LC3C_8-125
5DPW 2.19 Å, Crystal structure of PLEKHM1 LIR in complex with human LC3C_8-125
3VVW 2.5 Å, NDP52 in complex with LC3C
3WAP 3.1 Å, Crystal structure of Atg13 LIR-fused human LC3C_8-125

Browse structure collections

About this viewer

MolViewer shows 2NCN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.