Crystal structure of human LC3C_8-125. Determined by X-ray diffraction at 1.75 Å resolution. Released 25 Dec 2013.
Explore 3WAM in 3D Show helices and sheets RCSB PDB PDBe
3WAM contains 5 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-6 | 4 | |
| α-helix | 9-22 | 14 | |
| β-strand | 26-33 | 8 | 1 |
| α-helix | 41-42 | 2 | |
| β-strand | 43 | 1 | 2 |
| β-strand | 47-51 | 5 | 1 |
| β-strand | 55 | 1 | 3 |
| α-helix | 56-66 | 11 | |
| β-strand | 67 | 1 | 2 |
| β-strand | 76-79 | 4 | 1 |
| β-strand | 83-84 | 2 | 1 |
| β-strand | 90 | 1 | 3 |
| α-helix | 91-98 | 8 | |
| β-strand | 105-110 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Microtubule-associated proteins 1A/1B light chain 3C | A | protein | 120 | Homo sapiens | Q9BXW4 (AlphaFold model) |
>3WAM_1 Microtubule-associated proteins 1A/1B light chain 3C (chains A) GSPSVRPFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELT MTQFLSIIRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETF
| ID | Name | Formula | Copies |
|---|---|---|---|
| CIT | Citric acid | C6 H8 O7 | 1 |
Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki, H., Tabata, K., Morita, E. et al. Structure (2014) 22:47-58. DOI 10.1016/j.str.2013.09.023 · PubMed
Other PDB entries of the same protein (UniProt Q9BXW4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3WAM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.