2NPP: Protein Phosphatase 2A Holoenzyme
Structure of the Protein Phosphatase 2A Holoenzyme. Determined by X-ray diffraction at 3.3 Å resolution. Released 12 Dec 2006.
- Method
- X-ray diffraction
- Resolution
- 3.3 Å
- Organisms
- Homo sapiens, Cyanobacteria
- Chains
- 8
- Atoms
- 20,466
- Mol. weight
- 309.67 kDa
- Ligands
- MN
- Released
- 12 Dec 2006
Explore 2NPP in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
2NPP contains 196 α-helices and 32 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 55 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-19 | 8 | |
| α-helix | 25-33 | 9 | |
| α-helix | 35-42 | 8 | |
| α-helix | 44-46 | 3 | |
| α-helix | 47-51 | 5 | |
| α-helix | 52-56 | 5 | |
| α-helix | 63-73 | 11 | |
| α-helix | 83-89 | 7 | |
| α-helix | 90-96 | 7 | |
| α-helix | 102-114 | 13 | |
| α-helix | 121-123 | 3 | |
| α-helix | 124-128 | 5 | |
| α-helix | 129-136 | 8 | |
| α-helix | 141-148 | 8 | |
| α-helix | 151-154 | 4 | |
| α-helix | 160-174 | 15 | |
| α-helix | 179-193 | 15 | |
| α-helix | 198-200 | 3 | |
| α-helix | 201-205 | 5 | |
| α-helix | 206-213 | 8 | |
| α-helix | 218-232 | 15 | |
| α-helix | 237-243 | 7 | |
| α-helix | 245-253 | 9 | |
| α-helix | 257-265 | 9 | |
| α-helix | 267-274 | 8 | |
| α-helix | 276-278 | 3 | |
| α-helix | 279-283 | 5 | |
| α-helix | 284-291 | 8 | |
| α-helix | 296-303 | 8 | |
| α-helix | 306-311 | 6 | |
| α-helix | 318-321 | 4 | |
| α-helix | 322-326 | 5 | |
| α-helix | 327-334 | 8 | |
| α-helix | 339-348 | 10 | |
| α-helix | 349-352 | 4 | |
| α-helix | 353-360 | 8 | |
| α-helix | 361-365 | 5 | |
| α-helix | 366-373 | 8 | |
| α-helix | 378-385 | 8 | |
| α-helix | 388-391 | 4 | |
| α-helix | 397-402 | 6 | |
| α-helix | 405-411 | 7 | |
| α-helix | 417-434 | 18 | |
| α-helix | 436-441 | 6 | |
| α-helix | 444-450 | 7 | |
| α-helix | 456-473 | 18 | |
| α-helix | 475-479 | 5 | |
| α-helix | 495-520 | 26 | |
| α-helix | 522-527 | 6 | |
| α-helix | 528-530 | 3 | |
| α-helix | 534-546 | 13 | |
| α-helix | 553-555 | 3 | |
| α-helix | 556-560 | 5 | |
| α-helix | 561-568 | 8 | |
| α-helix | 573-586 | 14 | |
Chain B: 26 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 35-45 | 11 | |
| α-helix | 59-71 | 13 | |
| α-helix | 84-93 | 10 | |
| α-helix | 97-100 | 4 | |
| α-helix | 110-112 | 3 | |
| α-helix | 121-135 | 15 | |
| α-helix | 145-147 | 3 | |
| α-helix | 151-159 | 9 | |
| α-helix | 166-181 | 16 | |
| α-helix | 187-203 | 17 | |
| α-helix | 211-222 | 12 | |
| α-helix | 231-235 | 5 | |
| α-helix | 236-241 | 6 | |
| α-helix | 242-246 | 5 | |
| α-helix | 250-252 | 3 | |
| α-helix | 254-267 | 14 | |
| α-helix | 269-271 | 3 | |
| α-helix | 272-281 | 10 | |
| α-helix | 288-302 | 15 | |
| α-helix | 307-325 | 19 | |
| α-helix | 330-337 | 8 | |
| α-helix | 338-341 | 4 | |
| α-helix | 343-350 | 8 | |
| α-helix | 353-364 | 12 | |
| α-helix | 376-388 | 13 | |
| α-helix | 392-411 | 20 | |
Chain C: 15 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-18 | 16 | |
| α-helix | 22-24 | 3 | |
| α-helix | 25-40 | 16 | |
| β-strand | 45-48 | 4 | 1 |
| α-helix | 49 | 1 | |
| β-strand | 52-55 | 4 | 2 |
| α-helix | 62-72 | 11 | |
| β-strand | 80-82 | 3 | 2 |
| α-helix | 93-106 | 14 | |
| β-strand | 111-113 | 3 | 2 |
| α-helix | 121-126 | 6 | |
| α-helix | 129-137 | 9 | |
| α-helix | 141-151 | 11 | |
| β-strand | 156-159 | 4 | 1 |
| β-strand | 163-166 | 4 | 1 |
| α-helix | 177-182 | 6 | |
| α-helix | 194-200 | 7 | |
| β-strand | 202-203 | 2 | 3 |
| β-strand | 211 | 1 | 4 |
| β-strand | 218 | 1 | 4 |
| β-strand | 219-220 | 2 | 3 |
| α-helix | 222-232 | 11 | |
| β-strand | 236-239 | 4 | 1 |
| β-strand | 248-251 | 4 | 1 |
| β-strand | 256-259 | 4 | 1 |
| α-helix | 265-268 | 4 | |
| β-strand | 273-278 | 6 | 2 |
| β-strand | 286-289 | 4 | 2 |
| α-helix | 290-294 | 5 | |
| α-helix | 303-305 | 3 | |
Chain D: 59 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-16 | 5 | |
| α-helix | 19-21 | 3 | |
| α-helix | 25-33 | 9 | |
| α-helix | 35-42 | 8 | |
| α-helix | 44-46 | 3 | |
| α-helix | 47-51 | 5 | |
| α-helix | 52-56 | 5 | |
| α-helix | 63-73 | 11 | |
| α-helix | 83-88 | 6 | |
| α-helix | 90-96 | 7 | |
| α-helix | 102-116 | 15 | |
| α-helix | 121-123 | 3 | |
| α-helix | 124-128 | 5 | |
| α-helix | 129-137 | 9 | |
| α-helix | 141-149 | 9 | |
| α-helix | 151-154 | 4 | |
| α-helix | 155-157 | 3 | |
| α-helix | 160-174 | 15 | |
| α-helix | 179-193 | 15 | |
| α-helix | 198-200 | 3 | |
| α-helix | 201-205 | 5 | |
| α-helix | 206-213 | 8 | |
| α-helix | 218-232 | 15 | |
| α-helix | 237-239 | 3 | |
| α-helix | 240-243 | 4 | |
| α-helix | 245-253 | 9 | |
| α-helix | 257-265 | 9 | |
| α-helix | 267-274 | 8 | |
| α-helix | 276-278 | 3 | |
| α-helix | 279-283 | 5 | |
| α-helix | 284-291 | 8 | |
| α-helix | 296-311 | 16 | |
| α-helix | 318-321 | 4 | |
| α-helix | 322-326 | 5 | |
| α-helix | 327-333 | 7 | |
| α-helix | 339-348 | 10 | |
| α-helix | 349-351 | 3 | |
| α-helix | 353-360 | 8 | |
| α-helix | 361-365 | 5 | |
| α-helix | 366-372 | 7 | |
| α-helix | 378-385 | 8 | |
| α-helix | 388-391 | 4 | |
| α-helix | 397-402 | 6 | |
| α-helix | 405-410 | 6 | |
| α-helix | 411-413 | 3 | |
| α-helix | 417-434 | 18 | |
| α-helix | 436-442 | 7 | |
| α-helix | 444-449 | 6 | |
| α-helix | 450-452 | 3 | |
| α-helix | 456-473 | 18 | |
| α-helix | 475-481 | 7 | |
| α-helix | 495-520 | 26 | |
| α-helix | 522-527 | 6 | |
| α-helix | 528-530 | 3 | |
| α-helix | 534-546 | 13 | |
| α-helix | 553-555 | 3 | |
| α-helix | 556-560 | 5 | |
| α-helix | 561-568 | 8 | |
| α-helix | 573-585 | 13 | |
Chain E: 26 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 35-45 | 11 | |
| α-helix | 59-68 | 10 | |
| α-helix | 84-93 | 10 | |
| α-helix | 98-100 | 3 | |
| α-helix | 110-112 | 3 | |
| α-helix | 117-118 | 2 | |
| α-helix | 121-135 | 15 | |
| α-helix | 145-147 | 3 | |
| α-helix | 151-159 | 9 | |
| α-helix | 166-182 | 17 | |
| α-helix | 184-203 | 20 | |
| α-helix | 211-222 | 12 | |
| α-helix | 231-235 | 5 | |
| α-helix | 236-241 | 6 | |
| α-helix | 243-246 | 4 | |
| α-helix | 250-252 | 3 | |
| α-helix | 254-267 | 14 | |
| α-helix | 272-281 | 10 | |
| α-helix | 288-302 | 15 | |
| α-helix | 307-325 | 19 | |
| α-helix | 330-337 | 8 | |
| α-helix | 338-341 | 4 | |
| α-helix | 343-350 | 8 | |
| α-helix | 353-364 | 12 | |
| α-helix | 376-388 | 13 | |
| α-helix | 392-411 | 20 | |
Chain F: 15 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-18 | 16 | |
| α-helix | 22-24 | 3 | |
| α-helix | 25-40 | 16 | |
| β-strand | 45-48 | 4 | 5 |
| α-helix | 49 | 1 | |
| β-strand | 52-55 | 4 | 6 |
| α-helix | 62-72 | 11 | |
| β-strand | 80-82 | 3 | 6 |
| α-helix | 93-106 | 14 | |
| β-strand | 111-113 | 3 | 6 |
| α-helix | 121-126 | 6 | |
| α-helix | 129-137 | 9 | |
| α-helix | 141-151 | 11 | |
| β-strand | 156-159 | 4 | 5 |
| β-strand | 163-166 | 4 | 5 |
| α-helix | 177-182 | 6 | |
| α-helix | 188-190 | 3 | |
| α-helix | 194-200 | 7 | |
| β-strand | 202-203 | 2 | 7 |
| β-strand | 211 | 1 | 8 |
| β-strand | 218 | 1 | 8 |
| β-strand | 219-220 | 2 | 7 |
| α-helix | 222-232 | 11 | |
| β-strand | 236-239 | 4 | 5 |
| β-strand | 246 | 1 | 9 |
| β-strand | 248-251 | 4 | 5 |
| β-strand | 256-259 | 4 | 5 |
| α-helix | 265-268 | 4 | |
| β-strand | 272 | 1 | 9 |
| β-strand | 273-278 | 6 | 6 |
| β-strand | 286-289 | 4 | 6 |
| α-helix | 290-294 | 5 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Protein Phosphatase 2, regulatory subunit A (PR 65), alpha isoform | A, D | protein | 589 | Homo sapiens | P30153 (AlphaFold model) |
| Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform | B, E | protein | 449 | Homo sapiens | Q13362 (AlphaFold model) |
| Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform | C, F | protein | 309 | Homo sapiens | P67775 (AlphaFold model) |
| microcystin LR | X, Y | protein | 7 | Cyanobacteria | |
Sequence of entity 1 (A, D), FASTA
>2NPP_1 Protein Phosphatase 2, regulatory subunit A (PR 65), alpha isoform (chains A, D)
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA
Sequence of entity 2 (B, E), FASTA
>2NPP_2 Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform (chains B, E)
MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPL
SDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDP
EEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERD
FLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLK
EEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVMALLKYWPKTHSPK
EVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLIS
DNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEK
LKMKEREEAWVKIENLAKANPQVLKKRIT
Sequence of entity 3 (C, F), FASTA
>2NPP_3 Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform (chains C, F)
MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
Sequence of entity 4 (X, Y), FASTA
>2NPP_4 microcystin LR (chains X, Y)
ALDRXEX
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| MN | Manganese (II) ion | Mn | 4 |
Primary citation
Structure of the protein phosphatase 2A holoenzyme. Xu, Y., Xing, Y., Chen, Y. et al. Cell (2006) 127:1239-1251. DOI 10.1016/j.cell.2006.11.033 · PubMed
Other PDB entries of the same protein (UniProt P30153 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1B3U 2.3 Å, Crystal structure of constant regulatory domain of human PP2A, PR65ALPHA
- 4I5L 2.43 Å, Structural mechanism of trimeric PP2A holoenzyme involving PR70: insight for Cdc6…
- 8TWE 2.55 Å, Cryo-EM structure of the PP2A:B55-FAM122A complex, B55 body
- 2IE4 2.6 Å, Structure of the Protein Phosphatase 2A Core Enzyme Bound to okadaic acid
- 9C6B 2.6 Å, PP2A:B55-p107 substrate complex
- 8TWI 2.69 Å, Cryo-EM structure of the PP2A:B55-FAM122A complex, PP2Ac body
- 8U1X 2.7 Å, The structure of the PP2A-B56Delta holoenzyme mutant - E197K
- 9C7T 2.7 Å, PP2A:B55-Eya3 substrate complex
- 8TTB 2.77 Å, Cryo-EM structure of the PP2A:B55-ARPP19 complex
- 8SO0 2.8 Å, Cryo-EM structure of the PP2A:B55-FAM122A complex
- 2IE3 2.8 Å, Structure of the Protein Phosphatase 2A Core Enzyme Bound to Tumor-inducing Toxins
- 3C5W 2.8 Å, Complex between PP2A-specific methylesterase PME-1 and PP2A core enzyme
Browse structure collections
About this viewer
MolViewer shows 2NPP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.