2NSZ: Programmed cell death protein 4

1.15 Angstrom Crystal Structure of the MA3 domain of Pdcd4. Determined by X-ray diffraction at 1.15 Å resolution. Released 21 Nov 2006.

Method: X-ray diffraction
Resolution: 1.15 Å
Organism: Mus musculus
Chains: 1
Atoms: 1,331
Mol. weight: 15.29 kDa
Released: 21 Nov 2006

Explore 2NSZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2NSZ contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	326-341	16
α-helix	344-354	11
α-helix	357-359	3
α-helix	360-373	14
α-helix	378-392	15
α-helix	398-418	21
α-helix	422-435	14
α-helix	441-445	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Programmed cell death protein 4	A	protein	129	Mus musculus	Q61823 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2NSZ_1 Programmed cell death protein 4 (chains A)
QPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFK
MILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISK
QLRDLCPSR

Primary citation

Structural basis for inhibition of translation by the tumor suppressor Pdcd4. LaRonde-LeBlanc, N., Santhanam, A.N., Baker, A.R. et al. Mol Cell Biol (2007) 27:147-156. DOI 10.1128/MCB.00867-06 · PubMed

Other PDB entries of the same protein (UniProt Q61823 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ION 1.57 Å, Crystal structure of the C-terminal MA3 domain of Pdcd4 (mouse); form2
2IOS 1.76 Å, Crystal structure of the C-terminal MA3 domain of Pdcd4 (mouse); form 3
2IOL 2.0 Å, Crystal structure of the C-terminal MA3 domain of Pdcd4 (mouse); form 1
3EIQ 3.5 Å, Crystal structure of Pdcd4-eIF4A
2HM8 Solution Structure of the C-terminal MA-3 domain of Pdcd4
2KZT Structure of the Tandem MA-3 Region of Pdcd4

Browse structure collections

About this viewer

MolViewer shows 2NSZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.