Accommodation of positively-charged residues in a hydrophobic specificity pocket: Crystal structures of SGPB in complex with OMTKY3 variants Lys18I and Arg18I. Determined by X-ray diffraction at 1.65 Å resolution. Released 21 Nov 2006.
Explore 2NU2 in 3D Show helices and sheets RCSB PDB PDBe
2NU2 contains 4 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 18 | 1 | 1 |
| β-strand | 30-32 | 3 | 2 |
| β-strand | 41-43 | 3 | 2 |
| β-strand | 46-48B | 5 | 2 |
| β-strand | 49-54 | 6 | 2 |
| α-helix | 56-59 | 4 | |
| β-strand | 65-67 | 3 | 2 |
| β-strand | 84-93 | 9 | 2 |
| β-strand | 100 | 1 | 3 |
| β-strand | 103-108 | 6 | 2 |
| β-strand | 118-119 | 2 | 1 |
| β-strand | 122-123 | 2 | 1 |
| β-strand | 126-127 | 2 | 3 |
| β-strand | 135-140 | 6 | 3 |
| β-strand | 156-170 | 15 | 3 |
| β-strand | 176-183 | 8 | 3 |
| β-strand | 198-201 | 4 | 3 |
| β-strand | 208-219 | 12 | 3 |
| β-strand | 223-230 | 8 | 3 |
| α-helix | 231-237 | 8 | |
| β-strand | 240-241 | 2 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 16-17 | 2 | 3 |
| β-strand | 20 | 1 | 2 |
| β-strand | 23-25 | 3 | 4 |
| α-helix | 29 | 1 | |
| β-strand | 30-31 | 2 | 4 |
| α-helix | 34-43 | 10 | |
| β-strand | 50-53 | 4 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Streptogrisin B, Protease B | E | protein | 185 | Streptomyces griseus | P00777 (AlphaFold model) |
| Ovomucoid | I | protein | 51 | Meleagris gallopavo | P68390 (AlphaFold model) |
>2NU2_1 Streptogrisin B, Protease B (chains E) ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFP NNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNY GGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAY GVSVY
>2NU2_2 Ovomucoid (chains I) VDCSEYPKPACTREYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Accommodation of positively-charged residues in a hydrophobic specificity pocket: Crystal structures of SGPB in complex with OMTKY3 variants Lys18I and Arg18I. Bateman, K.S., Anderson, S., Lu, W. et al. To be published.
Other PDB entries of the same protein (UniProt P00777 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2NU2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.