2O3D: Human SF2/ASF RNA recognition motif 2

Structure of human SF2/ASF RNA recognition motif 2 (RRM2). Determined by solution NMR. Released 16 Oct 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 907
Mol. weight: 12.93 kDa
Released: 16 Oct 2007

Explore 2O3D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2O3D contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	122-126	5	1
α-helix	134-141	8
α-helix	142-144	3
β-strand	147-152	6	1
β-strand	157-162	6	1
α-helix	165-173	9
β-strand	178-182	5	2
β-strand	186-190	5	2
β-strand	191-194	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Splicing factor, arginine/serine-rich 1	A	protein	113	Homo sapiens	Q07955 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2O3D_1 Splicing factor, arginine/serine-rich 1 (chains A)
MAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRK
EDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSLEH

Primary citation

Structural and functional analysis of RNA and TAP binding to SF2/ASF. Tintaru, A.M., Hautbergue, G.M., Hounslow, A.M. et al. EMBO Rep (2007) 8:756-762. DOI 10.1038/sj.embor.7401031 · PubMed

Other PDB entries of the same protein (UniProt Q07955 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4C0O 2.56 Å, Transportin 3 in complex with phosphorylated ASF/SF2
3BEG 2.9 Å, Crystal structure of SR protein kinase 1 complexed to its substrate ASF/SF2
8QO9 5.29 Å, Cryo-EM structure of a human spliceosomal B complex protomer
7ABG 7.8 Å, Human pre-Bact-1 spliceosome
9R8V 8.5 Å, Cryo-EM structure of the human pre-Bact-OTS complex (whole map)
1X4A Solution structure of RRM domain in splicing factor SF2
2M7S NMR structure of RNA recognition motif 2 (RRM2) of Homo sapiens splicing factor,…
2M8D Structure of SRSF1 RRM2 in complex with the RNA 5'-UGAAGGAC-3'
6HPJ Structure of human SRSF1 RRM1 bound to AACAAA RNA

Browse structure collections

About this viewer

MolViewer shows 2O3D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.