2O6S: Variable lymphocyte receptor B

Structural diversity of the hagfish Variable Lymphocyte Receptors B59. Determined by X-ray diffraction at 1.5 Å resolution. Released 26 Dec 2006.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Eptatretus burgeri
Chains: 2
Atoms: 3,534
Mol. weight: 45.65 kDa
Released: 26 Dec 2006

Explore 2O6S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2O6S contains 6 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 3 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	29-31	3	1
β-strand	34-36	3	1
α-helix	45-46	2
β-strand	55-57	3	1
β-strand	79-81	3	1
β-strand	103-105	3	1
β-strand	127-129	3	1
β-strand	151-153	3	1
β-strand	175-177	3	1
β-strand	183	1	2
α-helix	191-199	9
β-strand	204	1	1
β-strand	205	1	3
β-strand	211	1	3
β-strand	217	1	4
β-strand	218	1	2
β-strand	224	1	4
α-helix	225-227	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Variable lymphocyte receptor B	A, B	protein	208	Eptatretus burgeri	Q4G1L3 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2O6S_1 Variable lymphocyte receptor B (chains A, B)
CPSRCSCSGTTVECYSQGRTSVPTGIPAQTTYLDLETNSLKSLPNGVFDELTSLTQLYLG
GNKLQSLPNGVFNKLTSLTYLNLSTNQLQSLPNGVFDKLTQLKELALNTNQLQSLPDGVF
DKLTQLKDLRLYQNQLKSVPDGVFDRLTSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGV
VRNSAGSVAPDSAKCSGSGKPVRSIICP

Primary citation

Structural diversity of the hagfish variable lymphocyte receptors. Kim, H.M., Oh, S.C., Lim, K.J. et al. J Biol Chem (2007) 282:6726-6732. DOI 10.1074/jbc.M608471200 · PubMed

Other PDB entries of the same protein (UniProt Q4G1L3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3RFS 1.7 Å, Design of a binding scaffold based on variable lymphocyte receptors of jawless…
4J4L 2.3 Å, Modular evolution and design of the protein binding interface
3A79 2.9 Å, Crystal structure of TLR2-TLR6-Pam2CSK4 complex
4UIP 2.95 Å, The complex structure of extracellular domain of EGFR with Repebody (rAC1).

Browse structure collections

About this viewer

MolViewer shows 2O6S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.