Solution structure of GIP in TFE/water. Determined by solution NMR. Released 5 Jun 2007.
Explore 2OBU in 3D Show helices and sheets RCSB PDB PDBe
2OBU contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-31 | 27 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Gastric inhibitory polypeptide | A | protein | 42 | P09681 (AlphaFold model) |
>2OBU_1 Gastric inhibitory polypeptide (chains A) YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
The bioactive conformation of glucose-dependent insulinotropic polypeptide by NMR and CD spectroscopy. Alana, I., Malthouse, J.P.G., O'harte, F.P.M. et al. Proteins (2007) 68:92-99. DOI 10.1002/prot.21372 · PubMed
Other PDB entries of the same protein (UniProt P09681 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2OBU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.