2ODC: Emerin

LEM-domain of the nuclear envelope protein emerin. Determined by solution NMR. Released 13 Mar 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 404
Mol. weight: 5.72 kDa
Released: 13 Mar 2007

Explore 2ODC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ODC contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain I: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	3-6	4
α-helix	9-18	10
α-helix	28-46	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Emerin	I	protein	47	Homo sapiens	P50402 (AlphaFold model)

Sequence of entity 1 (I), FASTA

>2ODC_1 Emerin (chains I)
HDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRR

Primary citation

Solution NMR Structure of the Barrier-to-Autointegration Factor-Emerin Complex. Cai, M., Huang, Y., Suh, J.Y. et al. J Biol Chem (2007) 282:14525-14535. DOI 10.1074/jbc.M700576200 · PubMed

Other PDB entries of the same protein (UniProt P50402 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NDY 1.44 Å, Di-phosphorylated Barrier-to-Autointegration Factor (BAF) in complex with LEM domain of…
6GHD 2.1 Å, Structural analysis of the ternary complex between lamin A/C, BAF and emerin identifies…
6RPR 2.26 Å, LEM domain of Emerin mutant T43I in complex with BAF dimer and the Igfold of the lamin A/C
1JEI Lem domain of human inner nuclear membrane protein emerin
2ODG Complex of barrier-to-autointegration factor and LEM-domain of emerin

Browse structure collections

About this viewer

MolViewer shows 2ODC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.