2OFZ: Nucleocapsid protein

Ultrahigh Resolution Crystal Structure of RNA Binding Domain of SARS Nucleopcapsid (N Protein) at 1.1 Angstrom Resolution in Monoclinic Form. Determined by X-ray diffraction at 1.17 Å resolution. Released 3 Apr 2007.

Method: X-ray diffraction
Resolution: 1.17 Å
Organism: SARS coronavirus Tor2
Chains: 1
Atoms: 1,289
Mol. weight: 15.45 kDa
Released: 3 Apr 2007

Explore 2OFZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OFZ contains 10 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	-5	1
β-strand	-4	1	1
α-helix	-3	1
β-strand	51	1	2
β-strand	54	1	3
α-helix	55-56	2
β-strand	57-58	2	4
α-helix	63-65	3
α-helix	73-75	3
α-helix	81-83	3
β-strand	85-91	7	4
β-strand	94-96	3	5
β-strand	102-104	3	5
α-helix	105-107	3
β-strand	108-113	6	4
α-helix	123	1
β-strand	131-135	5	4
β-strand	140	1	1
β-strand	150	1	2
α-helix	156-157	2
β-strand	158	1	3
α-helix	159-160	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleocapsid protein	A	protein	138	SARS coronavirus Tor2	P59595 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2OFZ_1 Nucleocapsid protein (chains A)
MGSDKIHHHHHHNTASWFTALTQHGKEELRFPRGQGVPINTNSGPDDQIGYYRRATRRVR
GGDGKMKELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTPKDHIGTRNPNNNA
ATVLQLPQGTTLPKGFYA

Primary citation

Ribonucleocapsid formation of severe acute respiratory syndrome coronavirus through molecular action of the N-terminal domain of N protein. Saikatendu, K.S., Joseph, J.S., Subramanian, V. et al. J Virol (2007) 81:3913-3921. DOI 10.1128/JVI.02236-06 · PubMed

Other PDB entries of the same protein (UniProt P59595 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1X7Q 1.45 Å, Crystal structure of HLA-A*1101 with sars nucleocapsid peptide
2GIB 1.75 Å, Crystal structure of the SARS coronavirus nucleocapsid protein dimerization domain
2OG3 1.85 Å, structure of the rna binding domain of n protein from SARS coronavirus in cubic crystal…
7LG0 2.3 Å, Human leukocyte antigen B*07:02 in complex with SARS-CoV2 epitope SPRWYFYYL
6IEX 2.31 Å, Crystal structure of HLA-B*4001 in complex with SARS-CoV derived peptide N216-225…
3I6L 2.4 Å, Newly identified epitope N1 derived from SARS-CoV N protein complexed with HLA-A*2402
2CJR 2.5 Å, Crystal structure of oligomerization domain of SARS coronavirus nucleocapsid protein.
1SSK Structure of the N-terminal RNA-binding Domain of the SARS CoV Nucleocapsid Protein
2JW8 Solution structure of stereo-array isotope labelled (SAIL) C-terminal dimerization…

Browse structure collections

About this viewer

MolViewer shows 2OFZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.