2OK0: Fab ED10-DNA complex

Fab ED10-DNA complex. Determined by X-ray diffraction at 1.89 Å resolution. Released 12 Jun 2007.

Method: X-ray diffraction
Resolution: 1.89 Å
Organism: Mus musculus
Chains: 3
Atoms: 3,542
Mol. weight: 48.19 kDa
Released: 12 Jun 2007

Explore 2OK0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OK0 contains 16 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	7
β-strand	10-12	3	8
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	33-39	7	8
β-strand	45-52	8	8
β-strand	56-59	4	8
α-helix	61-63	3
β-strand	67-72	6	7
β-strand	77-82	6	7
α-helix	84-86	3
β-strand	88-95	8	8
β-strand	103	1	8
β-strand	107-111	5	8
α-helix	114-116	3
β-strand	117	1	9
α-helix	118-119	2
β-strand	120-124	5	10
β-strand	137-147	11	10
β-strand	148	1	9
β-strand	153-157	4	11
α-helix	162-164	3
β-strand	171-173	3	10
α-helix	174-176	3
β-strand	177-179	3	10
β-strand	184-194	11	10
β-strand	206-212	7	11
α-helix	213-215	3
β-strand	217-223	7	11

Chain L: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	27C	1	3
β-strand	31	1	3
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	85-90	6	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-106	5	2
β-strand	111	1	4
α-helix	112-113	2
β-strand	114-118	5	5
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	5
β-strand	140	1	4
β-strand	144-150	7	6
β-strand	153-155	3	6
β-strand	159-163	5	5
α-helix	164-167	4
β-strand	173-182	10	5
α-helix	183-187	5
β-strand	191-198	8	6
β-strand	205-210	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(tpc)-3'	D	DNA	2
Fab ED10 light chain	L	protein	219	Mus musculus	A2NHM3 (AlphaFold model)
Fab ED10 heavy chain	H	protein	216	Mus musculus	A0N7J2 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>2OK0_1 5'-D(*TP*C)-3' (chains D)
TC

Sequence of entity 2 (L), FASTA

>2OK0_2 Fab ED10 light chain (chains L)
DILMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPTLLIYKVSNRF
SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHIPLTFGAGTKLEVKRSDAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 3 (H), FASTA

>2OK0_3 Fab ED10 heavy chain (chains H)
EVQLEESGPELVKPGASVKISCKASGYTFTDYYMNWLRQKPGQGLEWIGWVYPGSIKYNE
KFKDKATLTADTSSSIVYMHLSSLTSDDNAVYFCTRWTYGSSFDYWGEGTLLTVSSAKTT
PPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTL
SSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR

Primary citation

Specific recognition of a DNA immunogen by its elicited antibody. Sanguineti, S., Centeno Crowley, J.M., Lodeiro Merlo, M.F. et al. J Mol Biol (2007) 370:183-195. DOI 10.1016/j.jmb.2007.04.046 · PubMed

Other PDB entries of the same protein (UniProt A2NHM3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6PXR 1.56 Å, Anti-TAU BIIB092 FAB with TAU peptide
4TPR 1.6 Å, Structure of Tau5 antibody Fab fragment
4TQE 1.6 Å, Structure of tau peptide in complex with Tau5 antibody Fab fragment
3V4U 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
3UO1 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
2IPU 1.65 Å, PFA1 Fab fragment complexed with Abeta 1-8 peptide
3V52 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
2DQU 1.7 Å, Crystal form II: high resolution crystal structure of the complex of the hydrolytic…
3UYR 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
1ZEA 1.78 Å, Structure of the anti-cholera toxin antibody Fab fragment TE33 in complex with a D-peptide
1PZ5 1.8 Å, Structural basis of peptide-carbohydrate mimicry in an antibody combining site
2DQT 1.8 Å, High resolution crystal structure of the complex of the hydrolytic antibody Fab 6D9 and…

Browse structure collections

About this viewer

MolViewer shows 2OK0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.