Fab ED10-DNA complex. Determined by X-ray diffraction at 1.89 Å resolution. Released 12 Jun 2007.
Explore 2OK0 in 3D Show helices and sheets RCSB PDB PDBe
2OK0 contains 16 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-6 | 4 | 7 |
| β-strand | 10-12 | 3 | 8 |
| β-strand | 18-25 | 8 | 7 |
| α-helix | 29-31 | 3 | |
| β-strand | 33-39 | 7 | 8 |
| β-strand | 45-52 | 8 | 8 |
| β-strand | 56-59 | 4 | 8 |
| α-helix | 61-63 | 3 | |
| β-strand | 67-72 | 6 | 7 |
| β-strand | 77-82 | 6 | 7 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-95 | 8 | 8 |
| β-strand | 103 | 1 | 8 |
| β-strand | 107-111 | 5 | 8 |
| α-helix | 114-116 | 3 | |
| β-strand | 117 | 1 | 9 |
| α-helix | 118-119 | 2 | |
| β-strand | 120-124 | 5 | 10 |
| β-strand | 137-147 | 11 | 10 |
| β-strand | 148 | 1 | 9 |
| β-strand | 153-157 | 4 | 11 |
| α-helix | 162-164 | 3 | |
| β-strand | 171-173 | 3 | 10 |
| α-helix | 174-176 | 3 | |
| β-strand | 177-179 | 3 | 10 |
| β-strand | 184-194 | 11 | 10 |
| β-strand | 206-212 | 7 | 11 |
| α-helix | 213-215 | 3 | |
| β-strand | 217-223 | 7 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 10-13 | 4 | 2 |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 27C | 1 | 3 |
| β-strand | 31 | 1 | 3 |
| β-strand | 33-38 | 6 | 2 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-75 | 6 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 85-90 | 6 | 2 |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 2 |
| β-strand | 102-106 | 5 | 2 |
| β-strand | 111 | 1 | 4 |
| α-helix | 112-113 | 2 | |
| β-strand | 114-118 | 5 | 5 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-127 | 6 | |
| β-strand | 129-139 | 11 | 5 |
| β-strand | 140 | 1 | 4 |
| β-strand | 144-150 | 7 | 6 |
| β-strand | 153-155 | 3 | 6 |
| β-strand | 159-163 | 5 | 5 |
| α-helix | 164-167 | 4 | |
| β-strand | 173-182 | 10 | 5 |
| α-helix | 183-187 | 5 | |
| β-strand | 191-198 | 8 | 6 |
| β-strand | 205-210 | 6 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 5'-d(*tp*c)-3' | D | DNA | 2 | ||
| Fab ED10 light chain | L | protein | 219 | Mus musculus | A2NHM3 (AlphaFold model) |
| Fab ED10 heavy chain | H | protein | 216 | Mus musculus | A0N7J2 (AlphaFold model) |
>2OK0_1 5'-D(*TP*C)-3' (chains D) TC
>2OK0_2 Fab ED10 light chain (chains L) DILMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPTLLIYKVSNRF SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHIPLTFGAGTKLEVKRSDAAPTV SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>2OK0_3 Fab ED10 heavy chain (chains H) EVQLEESGPELVKPGASVKISCKASGYTFTDYYMNWLRQKPGQGLEWIGWVYPGSIKYNE KFKDKATLTADTSSSIVYMHLSSLTSDDNAVYFCTRWTYGSSFDYWGEGTLLTVSSAKTT PPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTL SSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Specific recognition of a DNA immunogen by its elicited antibody. Sanguineti, S., Centeno Crowley, J.M., Lodeiro Merlo, M.F. et al. J Mol Biol (2007) 370:183-195. DOI 10.1016/j.jmb.2007.04.046 · PubMed
Other PDB entries of the same protein (UniProt A2NHM3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2OK0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.