2ONQ: Immunoglobulin G-binding protein G

Gbeta1 stabilization by in vitro evolution and computational design. Determined by X-ray diffraction at 1.7 Å resolution. Released 8 Jan 2008.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Streptococcus sp.
Chains: 1
Atoms: 480
Mol. weight: 6.33 kDa
Released: 8 Jan 2008

Explore 2ONQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ONQ contains 1 α-helix and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
β-strand	13-19	7	1
α-helix	23-36	14
β-strand	42-46	5	1
β-strand	51-55	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin G-binding protein G	A	protein	56	Streptococcus sp.	P19909 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2ONQ_1 Immunoglobulin G-binding protein G (chains A)
MQFKLIINGKTLKGEITIEAVDAAEAEKFFKQYANDNGIDGEWTYDDATKTFTVTE

Primary citation

Optimization of the gbeta1 domain by computational design and by in vitro evolution: structural and energetic basis of stabilization. Wunderlich, M., Max, K.E., Roske, Y. et al. J Mol Biol (2007) 373:775-784. DOI 10.1016/j.jmb.2007.08.004 · PubMed

Other PDB entries of the same protein (UniProt P19909 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FIL 0.88 Å, Structural and energetic determinants for hyperstable variants of GB1 obtained from…
2QMT 1.05 Å, Crystal Polymorphism of Protein GB1 Examined by Solid-state NMR and X-ray Diffraction
9I2I 1.08 Å, X-ray structure of the B1 domain of streptococcal protein G triple mutant T2Q, N8D, and…
6CHE 1.1 Å, Selenomethionine mutant (A34Sem) of protein GB1 examined by X-ray diffraction
6CPZ 1.12 Å, Selenomethionine mutant (I6Sem) of protein GB1 examined by X-ray diffraction
2GI9 1.14 Å, Backbone Conformational Constraints in a Microcrystalline U-15N-Labeled Protein by 3D…
6C9O 1.2 Å, Selenomethionine mutant (V29Sem) of protein GB1 examined by X-ray diffraction
6CTE 1.2 Å, 77Se-NMR probes the protein environment of selenomethionine
6OC7 1.3 Å, HMP42 Fab in complex with Protein G
6NLA 1.34 Å, Crystal structure of de novo designed metal-controlled dimer of B1…
2ON8 1.35 Å, Gbeta1 stabilization by in vitro evolution and computational design
12LO 1.37 Å, X-ray crystal structure of Protein GB1 mutant K13A

Browse structure collections

About this viewer

MolViewer shows 2ONQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.