WW4. Determined by solution NMR. Released 11 Dec 2007.
Explore 2OP7 in 3D Show helices and sheets RCSB PDB PDBe
2OP7 contains 0 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-12 | 4 | 1 |
| β-strand | 20-23 | 4 | 1 |
| β-strand | 29-30 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| NEDD4-like E3 ubiquitin-protein ligase WWP1 | A | protein | 39 | Homo sapiens | Q9H0M0 (AlphaFold model) |
>2OP7_1 NEDD4-like E3 ubiquitin-protein ligase WWP1 (chains A) NEEPLPEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKS
NMR structure of the forth WW domain of WWP1. Qin, H.N., Li, M.F., Pu, H. et al. To be published.
Other PDB entries of the same protein (UniProt Q9H0M0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2OP7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.