Structure of the Skp1-Fbw7-CyclinEdegC complex. Determined by X-ray diffraction at 2.6 Å resolution. Released 24 Apr 2007.
Explore 2OVQ in 3D Show helices and sheets RCSB PDB PDBe
2OVQ contains 20 α-helices and 37 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1004-1008 | 5 | 1 |
| β-strand | 1013-1016 | 4 | 1 |
| α-helix | 1021-1023 | 3 | |
| α-helix | 1025-1029 | 5 | |
| α-helix | 1030-1034 | 5 | |
| β-strand | 1044-1047 | 4 | 1 |
| α-helix | 1052-1062 | 11 | |
| α-helix | 1089-1092 | 4 | |
| α-helix | 1097-1110 | 14 | |
| α-helix | 1113-1124 | 12 | |
| α-helix | 1132-1139 | 8 | |
| α-helix | 1147-1156 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2265-2272 | 8 | |
| α-helix | 2280-2283 | 4 | |
| α-helix | 2286-2293 | 8 | |
| α-helix | 2298-2304 | 7 | |
| α-helix | 2309-2315 | 7 | |
| α-helix | 2318-2327 | 10 | |
| α-helix | 2350-2367 | 18 | |
| α-helix | 2371-2373 | 3 | |
| β-strand | 2374-2377 | 4 | 2 |
| β-strand | 2384-2390 | 7 | 3 |
| β-strand | 2393-2398 | 6 | 3 |
| β-strand | 2403-2407 | 5 | 3 |
| β-strand | 2413-2417 | 5 | 3 |
| β-strand | 2424-2430 | 7 | 4 |
| β-strand | 2433-2438 | 6 | 4 |
| β-strand | 2443-2447 | 5 | 4 |
| β-strand | 2453-2457 | 5 | 4 |
| β-strand | 2464-2470 | 7 | 5 |
| β-strand | 2473-2478 | 6 | 5 |
| β-strand | 2482-2487 | 6 | 5 |
| β-strand | 2493-2498 | 6 | 5 |
| β-strand | 2504-2509 | 6 | 6 |
| β-strand | 2514-2518 | 5 | 6 |
| β-strand | 2523-2527 | 5 | 6 |
| α-helix | 2528-2530 | 3 | |
| β-strand | 2532-2537 | 6 | 6 |
| β-strand | 2544-2549 | 6 | 7 |
| β-strand | 2553-2558 | 6 | 7 |
| β-strand | 2563-2567 | 5 | 7 |
| β-strand | 2573-2577 | 5 | 7 |
| β-strand | 2584-2590 | 7 | 8 |
| β-strand | 2593-2598 | 6 | 8 |
| β-strand | 2603-2607 | 5 | 8 |
| β-strand | 2613-2617 | 5 | 8 |
| β-strand | 2627-2632 | 6 | 9 |
| β-strand | 2636-2641 | 6 | 9 |
| β-strand | 2645-2650 | 6 | 9 |
| β-strand | 2656-2662 | 7 | 9 |
| α-helix | 2666-2668 | 3 | |
| β-strand | 2671-2677 | 7 | 2 |
| β-strand | 2681-2687 | 7 | 2 |
| β-strand | 2696-2701 | 6 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 376 | 1 | 10 |
| β-strand | 378 | 1 | 10 |
| α-helix | 381-383 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| S-phase kinase-associated protein 1A | A | protein | 149 | Homo sapiens | P63208 (AlphaFold model) |
| F-box/WD repeat protein 7 | B | protein | 445 | Homo sapiens | Q969H0 (AlphaFold model) |
| cyclinE C-terminal degron | C | protein | 12 |
>2OVQ_1 S-phase kinase-associated protein 1A (chains A) MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDPVPLPNVNAAILKKVIQWCTHHK DDPGGSGTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEE IRKTFNIKNDFTEEEEAQVRKENQWCEEK
>2OVQ_2 F-box/WD repeat protein 7 (chains B) TQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWR EKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDH VITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRT LKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVA AVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTS IRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNK HQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKL VCAVGSRNGTEETKLLVLDFDVDMK
>2OVQ_3 cyclinE C-terminal degron (chains C) LPSGLLTPPQSG
Structure of a Fbw7-Skp1-Cyclin E Complex: Multisite-Phosphorylated Substrate Recognition by SCF Ubiquitin Ligases. Hao, B., Oehlmann, S., Sowa, M.E. et al. Mol Cell (2007) 26:131-143. DOI 10.1016/j.molcel.2007.02.022 · PubMed
Other PDB entries of the same protein (UniProt P63208 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2OVQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.