2OVQ: Skp1-Fbw7-CyclinEdegC complex

Structure of the Skp1-Fbw7-CyclinEdegC complex. Determined by X-ray diffraction at 2.6 Å resolution. Released 24 Apr 2007.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,896
Mol. weight: 69.23 kDa
Released: 24 Apr 2007

Explore 2OVQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OVQ contains 20 α-helices and 37 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	1004-1008	5	1
β-strand	1013-1016	4	1
α-helix	1021-1023	3
α-helix	1025-1029	5
α-helix	1030-1034	5
β-strand	1044-1047	4	1
α-helix	1052-1062	11
α-helix	1089-1092	4
α-helix	1097-1110	14
α-helix	1113-1124	12
α-helix	1132-1139	8
α-helix	1147-1156	10

Chain B: 10 helices, 32 β-strands

Element	Residues	Length	Sheet
α-helix	2265-2272	8
α-helix	2280-2283	4
α-helix	2286-2293	8
α-helix	2298-2304	7
α-helix	2309-2315	7
α-helix	2318-2327	10
α-helix	2350-2367	18
α-helix	2371-2373	3
β-strand	2374-2377	4	2
β-strand	2384-2390	7	3
β-strand	2393-2398	6	3
β-strand	2403-2407	5	3
β-strand	2413-2417	5	3
β-strand	2424-2430	7	4
β-strand	2433-2438	6	4
β-strand	2443-2447	5	4
β-strand	2453-2457	5	4
β-strand	2464-2470	7	5
β-strand	2473-2478	6	5
β-strand	2482-2487	6	5
β-strand	2493-2498	6	5
β-strand	2504-2509	6	6
β-strand	2514-2518	5	6
β-strand	2523-2527	5	6
α-helix	2528-2530	3
β-strand	2532-2537	6	6
β-strand	2544-2549	6	7
β-strand	2553-2558	6	7
β-strand	2563-2567	5	7
β-strand	2573-2577	5	7
β-strand	2584-2590	7	8
β-strand	2593-2598	6	8
β-strand	2603-2607	5	8
β-strand	2613-2617	5	8
β-strand	2627-2632	6	9
β-strand	2636-2641	6	9
β-strand	2645-2650	6	9
β-strand	2656-2662	7	9
α-helix	2666-2668	3
β-strand	2671-2677	7	2
β-strand	2681-2687	7	2
β-strand	2696-2701	6	2

Chain C: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	376	1	10
β-strand	378	1	10
α-helix	381-383	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
S-phase kinase-associated protein 1A	A	protein	149	Homo sapiens	P63208 (AlphaFold model)
F-box/WD repeat protein 7	B	protein	445	Homo sapiens	Q969H0 (AlphaFold model)
cyclinE C-terminal degron	C	protein	12

Sequence of entity 1 (A), FASTA

>2OVQ_1 S-phase kinase-associated protein 1A (chains A)
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDPVPLPNVNAAILKKVIQWCTHHK
DDPGGSGTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEE
IRKTFNIKNDFTEEEEAQVRKENQWCEEK

Sequence of entity 2 (B), FASTA

>2OVQ_2 F-box/WD repeat protein 7 (chains B)
TQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWR
EKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDH
VITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRT
LKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVA
AVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTS
IRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNK
HQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKL
VCAVGSRNGTEETKLLVLDFDVDMK

Sequence of entity 3 (C), FASTA

>2OVQ_3 cyclinE C-terminal degron (chains C)
LPSGLLTPPQSG

Primary citation

Structure of a Fbw7-Skp1-Cyclin E Complex: Multisite-Phosphorylated Substrate Recognition by SCF Ubiquitin Ligases. Hao, B., Oehlmann, S., Sowa, M.E. et al. Mol Cell (2007) 26:131-143. DOI 10.1016/j.molcel.2007.02.022 · PubMed

Other PDB entries of the same protein (UniProt P63208 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FS1 1.8 Å, Insights into scf ubiquitin ligases from the structure of the SKP1-SKP2 complex
6M90 2.05 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-2776 ternary complex
2AST 2.3 Å, Crystal structure of Skp1-Skp2-Cks1 in complex with a p27 peptide
6M92 2.35 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-2663 ternary complex
2E31 2.4 Å, Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase
6M91 2.4 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-103094 ternary complex
2OVR 2.5 Å, Structure of the Skp1-Fbw7-CyclinEdegN complex
6M93 2.5 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-1933 ternary complex
6WNX 2.5 Å, FBXW11-SKP1 in complex with a pSer33/pSer37 Beta-Catenin peptide
5IBK 2.5 Å, Skp1-F-box in complex with a ubiquitin variant
6O60 2.5 Å, Crystal structure of GGTase3-FBXL2-SKP1 complex
5JH5 2.55 Å, Structural Basis for the Hierarchical Assembly of the Core of PRC1.1

Browse structure collections

About this viewer

MolViewer shows 2OVQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.