7T1Y: Fbw7-Skp1-MycCdegron complex

Structure of the Fbw7-Skp1-MycCdegron complex. Determined by X-ray diffraction at 2.55 Å resolution. Released 16 Feb 2022.

Method: X-ray diffraction
Resolution: 2.55 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,676
Mol. weight: 73.35 kDa
Released: 16 Feb 2022

Explore 7T1Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7T1Y contains 21 α-helices and 35 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	1
β-strand	13-17	5	1
α-helix	18-21	4
α-helix	25-29	5
α-helix	30-34	5
β-strand	46-47	2	1
α-helix	52-63	12
α-helix	87-92	6
α-helix	97-110	14
α-helix	113-128	16
α-helix	132-139	8
α-helix	147-156	10

Chain B: 11 helices, 32 β-strands

Element	Residues	Length	Sheet
α-helix	264-272	9
α-helix	274-276	3
α-helix	280-283	4
α-helix	286-293	8
α-helix	298-304	7
α-helix	309-314	6
α-helix	318-327	10
α-helix	350-367	18
α-helix	371-373	3
β-strand	374-377	4	2
β-strand	384-390	7	3
β-strand	393-398	6	3
β-strand	403-407	5	3
β-strand	413-417	5	3
β-strand	424-429	6	4
β-strand	433-438	6	4
β-strand	443-447	5	4
β-strand	452-457	6	4
β-strand	464-469	6	5
β-strand	473-478	6	5
β-strand	482-487	6	5
β-strand	493-498	6	5
α-helix	503	1
β-strand	504-509	6	6
β-strand	514-518	5	6
β-strand	522-527	6	6
β-strand	532-538	7	6
β-strand	544-549	6	7
β-strand	553-558	6	7
β-strand	563-567	5	7
β-strand	573-577	5	7
β-strand	584-590	7	8
β-strand	593-598	6	8
β-strand	603-607	5	8
β-strand	613-617	5	8
β-strand	627-632	6	9
β-strand	636-641	6	9
β-strand	645-650	6	9
β-strand	656-662	7	9
α-helix	666-668	3
β-strand	671-677	7	2
β-strand	681-687	7	2
β-strand	696-701	6	2

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	245-247	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
S-phase kinase-associated protein 1	A	protein	156	Homo sapiens	P63208 (AlphaFold model)
F-box/WD repeat-containing protein 7	B	protein	457	Homo sapiens	Q969H0 (AlphaFold model)
Myc proto-oncogene protein C terminal degron	C	protein	30	Homo sapiens	P01106 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7T1Y_1 S-phase kinase-associated protein 1 (chains A)
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDVPLPNVNAAILKKVIQWCTHHKD
DPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMI
KGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK

Sequence of entity 2 (B), FASTA

>7T1Y_2 F-box/WD repeat-containing protein 7 (chains B)
SHHHHHHGGSGMTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRY
WRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGEL
KSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMR
DNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIET
GQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFD
GIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKT
GQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGG
VVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK

Sequence of entity 3 (C), FASTA

>7T1Y_3 Myc proto-oncogene protein C terminal degron (chains C)
PEPLVLHEETPPTTSSDSEEEQEDEEIDVV

Primary citation

Two diphosphorylated degrons control c-Myc degradation by the Fbw7 tumor suppressor. Welcker, M., Wang, B., Rusnac, D.V. et al. Sci Adv (2022) 8:eabl7872-eabl7872. DOI 10.1126/sciadv.abl7872 · PubMed

Other PDB entries of the same protein (UniProt P63208 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FS1 1.8 Å, Insights into scf ubiquitin ligases from the structure of the SKP1-SKP2 complex
6M90 2.05 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-2776 ternary complex
2AST 2.3 Å, Crystal structure of Skp1-Skp2-Cks1 in complex with a p27 peptide
6M92 2.35 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-2663 ternary complex
2E31 2.4 Å, Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase
6M91 2.4 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-103094 ternary complex
2OVR 2.5 Å, Structure of the Skp1-Fbw7-CyclinEdegN complex
6M93 2.5 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-1933 ternary complex
6WNX 2.5 Å, FBXW11-SKP1 in complex with a pSer33/pSer37 Beta-Catenin peptide
5IBK 2.5 Å, Skp1-F-box in complex with a ubiquitin variant
6O60 2.5 Å, Crystal structure of GGTase3-FBXL2-SKP1 complex
5JH5 2.55 Å, Structural Basis for the Hierarchical Assembly of the Core of PRC1.1

Browse structure collections

About this viewer

MolViewer shows 7T1Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.